KEGG   Geobacillus lituanicus: GLN3_06885Help
Entry
GLN3_06885        CDS       T05193                                 

Definition
(GenBank) bacillolysin
  KO
K01400  bacillolysin [EC:3.4.24.28]
Organism
gli  Geobacillus lituanicus
Brite
KEGG Orthology (KO) [BR:gli00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:gli01002]
    GLN3_06885
Enzymes [BR:gli01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.28  bacillolysin
     GLN3_06885
Peptidases [BR:gli01002]
 Metallo Peptidases
  Family M4: thermolysin family
   GLN3_06885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M4_C Peptidase_M4 FTP PepSY
Motif
Other DBs
NCBI-ProteinID: ASS86875
UniProt: A0A223DV87
LinkDB All DBs
Position
complement(1377633..1379279)
Genome map
AA seq 548 aa AA seqDB search
MNKRAMLGAIGLAFGLLAAPIGASAKGESIVWNEQWKTPSFVSGSLLNGGEQAPEELVYQ
YVDRENGTFRLGGRARDRLALIGKQTDELGHTVMRFEQRHHGIPVYGAMLAAHVKDGELI
ALSGSLIPNLDGQPRLKKAKTVTVQQAEAIAEQDVTETVTKERPTTENGERTRLVIYPTD
GTARLAYEVNVRFLTPVPGNWVYIIDATDGAILNKFNQIDTAKPGGGQPVAGASTVGVGR
GVLGDQKYINTTYSSYYGYYYLQDNTRGSGIFTYDGRNRTTLPGSLWADGDNQLFASYDA
VAVDAHYYAGVVYDYYKNVHGRLSYDGSNAAIRSTVHYGRGYNNAFWNGSQMVYGDGDGQ
TFLPFSGGIDVVGHELTHAVTDYTAGLVYQNESGAINEAMSDIFGTLVEFYANRNPDWEI
GEDIYTPGVAGDALRSMSDPAKYGDPDHYSKRYTGTQDNGGVHTNSGIINKAAYLLSQGG
VHYGVSVTGIGRDKMGKIFYRALVYYLTPTSNFSQLRAACVQAAADLYGSTSQEVNSVKQ
AFDAVGVY
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaacgggcgatgctcggggcgatcgggctggcgttcggcctgctggcggcgccg
atcggcgcttcggcgaagggggaatcgatcgtctggaacgaacaatggaagacgccgtca
ttcgtgtccggttcgttgctaaacggaggggaacaagcgccggaagagctcgtttatcaa
tacgtcgatcgggaaaacggcacattccgcctcggcggacgcgcccgcgaccgtttggcg
ctgatcggcaaacagactgacgaacttggccataccgtgatgcggtttgaacagcggcat
cacggtataccggtttacggcgccatgctggctgcccatgtgaaagatggcgagctgatc
gcgctgtcggggtctttaattcccaatttagacggccagccgcggttgaaaaaggcgaaa
acggtcaccgtccaacaggcggaagctattgccgagcaagatgtaacggagacagtgacg
aaggagcggccgacaaccgaaaacggcgagcggacgcggctcgtcatttacccgactgat
ggcacggcccgcctcgcttatgaagtgaacgtccgctttttaaccccggttcccggcaac
tgggtgtatatcattgatgcaaccgatggggccattttgaataagttcaaccaaatcgac
accgccaagcccggcggcgggcagccggtcgccggcgcgtcgacggtcggcgtgggccgg
ggtgtgttgggggatcagaaatatatcaatacgacgtattcctcgtattacggctactac
tatttgcaagacaatacgcgcggcagcggcatttttacgtatgacggacgaaaccgcact
acactgcccggcagcttgtgggccgatggcgacaaccaactgttcgccagctatgacgcg
gtggccgtggacgcccattattacgccggcgtcgtgtatgattactacaaaaatgtgcac
ggccgcctgagctatgacggcagcaacgccgccatccgttcgaccgtccattatggccgt
ggctacaacaacgcgttttggaacggttcgcaaatggtgtacggcgatggcgatggacag
acgtttttgccgttttccggcggcattgacgtcgttgggcatgagttgacccatgcggtg
acggattatacggccgggcttgtttaccaaaacgaatctggcgccatcaatgaagcgatg
tccgatattttcggcacgctcgtggagttctacgccaaccgcaacccggactgggagatt
ggcgaagacatttacacgcctggggtcgccggcgatgcgctccgctcgatgtccgacccg
gcgaaatacggcgatccggatcattattccaaacggtacaccggcacgcaagacaacggc
ggcgtccatacgaacagcggcatcatcaataaagcggcgtacttgctcagccaaggcggc
gtccattacggcgtgagcgtcaccggcatcggccgcgacaaaatggggaaaattttctac
cgggcgcttgtctactatttgacgccgacgtcgaacttcagccagctgcgcgccgcctgc
gtgcaagcggccgctgatttgtacgggtcgacaagccaagaagtcaactcggtgaaacag
gcgttcgatgcggttggagtgtattaa

DBGET integrated database retrieval system