KEGG   Geobacillus lituanicus: GLN3_07630Help
Entry
GLN3_07630        CDS       T05193                                 

Definition
(GenBank) sporulation protein
Organism
gli  Geobacillus lituanicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Spore_YhcN_YlaJ
Motif
Other DBs
NCBI-ProteinID: ASS86983
UniProt: A0A223DVK9
LinkDB All DBs
Position
1515571..1516257
Genome map
AA seq 228 aa AA seqDB search
MNRCWIVAAFGTAIALAGCAQTAQDENTDVYKRSGNTINVTDRNELYNENGVPNGDDTPM
NNFGYVRHQKSPILGDANGYNDMPSFNREKAADLISKLCTQLPGVNDVATLVTDEEVLVV
YDADTKNRQQTADQVKKTALSVVPRYYHVYIADNPQLMKDIERFGLLDSNARNIDQLLDA
TIQRMLKYPQGKKLSDGENENGEMINETNDHLDRDFRDGTPRPTPAGR
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgatgttggatcgtcgccgcgttcggaacggcgatcgccctggccggctgcgcg
cagacggcgcaggacgaaaacaccgacgtctacaaacggagcggcaatacgatcaatgtg
accgaccgcaatgagctgtacaacgaaaacggggtgccaaacggcgatgacacgccgatg
aacaacttcggctacgtccgccatcaaaaaagcccgatcctcggcgatgcaaacggctat
aacgacatgccgtcgttcaaccgcgagaaagccgccgatttaatcagcaaactgtgcacg
cagctgccgggcgtcaacgacgtcgccacgctcgtcaccgatgaagaggtgcttgtcgtc
tatgacgccgacacaaaaaatcggcagcaaaccgccgaccaagtgaaaaagacagcgctg
tccgtcgttccccgctactaccatgtgtatatcgccgacaatccacagctgatgaaagac
attgagcgcttcgggctccttgattcgaacgcgcgcaatatcgaccaacttctcgatgcc
acgattcagcggatgttgaaatatccgcaagggaaaaagctgagcgacggggaaaatgaa
aacggcgaaatgatcaacgagacaaacgatcacctcgaccgcgacttccgcgacggcacg
ccgcggccgacgccggccggacggtag

DBGET integrated database retrieval system