KEGG   Geobacillus lituanicus: GLN3_08695Help
Entry
GLN3_08695        CDS       T05193                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
gli  Geobacillus lituanicus
Pathway
gli00010  Glycolysis / Gluconeogenesis
gli00620  Pyruvate metabolism
gli01100  Metabolic pathways
gli01110  Biosynthesis of secondary metabolites
gli01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gli00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GLN3_08695
   00620 Pyruvate metabolism
    GLN3_08695
Enzymes [BR:gli01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     GLN3_08695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: ASS87161
UniProt: A0A223DW03
LinkDB All DBs
Position
1739779..1741299
Genome map
AA seq 506 aa AA seqDB search
MIYAQPGQPGALVTFKKRYENFIGGKWVPPVDGEYFENITPITGQPYCEVPRSKAADIEL
ALDAAHAAKDAWGRTSPAERARLLNKIADRMEEHLEMLAVAETWENGKPIRETLAADIPL
AIDHFRYFASCIRAQEGTISEIDHDTVAYHFKEPLGVVGQIIPWNFPILMAAWKLAPALA
AGNCVVLKPAEQTPTSILVLIELIEDLLPPGVVNIVNGFGLEAGKPLASNPRVAKVAFTG
ETTTGRLIMQYASQNIVPVTLELGGKSPNIFFADVMDKDDDFLDKALEGFTMFALNQGEV
CTCPSRALIHESIYDAFMERALERVKQIKQGNPLDTETMIGAQASSEQLEKILSYIDIGK
QEGAELLIGGERNMLEGELSGGYYVKPTVFKGHNKMRIFQEEIFGPVLAVTTFKDHDEAL
SIANETLYGLGAGVWTRDINTAYRFGRGIQAGRVWTNCYHIYPAHAAFGGYKMSGIGRET
HKMMLDHYQQTKNLLVSYSPKKLGLF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgatctacgcacaaccaggccagccaggcgcgcttgtcacatttaaaaagcgctacgaa
aacttcattggcggcaaatgggtgccgccggtcgacggcgagtatttcgaaaatatcaca
ccaatcaccggacagccgtattgcgaagtgccgcgctcaaaagcggcggacatcgaactg
gcgcttgacgccgcccatgcggcaaaagacgcatggggacgcacgtctccagcggagcgc
gcccgtttgctgaacaaaatcgccgatcggatggaagaacatttggaaatgctggccgtc
gccgaaacgtgggaaaacggcaagccgatccgcgagacgctcgcggctgacattccgctt
gccatcgaccatttccgctattttgccagctgcatccgcgcgcaagaaggcacgatttca
gaaatcgatcacgacacggtcgcctatcatttcaaagaaccgctcggcgtcgtcgggcaa
atcatcccgtggaacttcccgattttaatggcggcctggaaactcgcgccagcgctcgcg
gccggcaactgcgtcgtgttgaaaccggcggagcaaacgccgacgtcgatcctcgttctc
atcgaactcatcgaagatttgcttccgcctggcgtcgtcaacatcgtcaacggctttggc
ttagaagccggcaagccgctcgcctcgaacccgcgcgtggcgaaagtggcgttcaccggt
gaaacgacgaccggacggctcatcatgcagtacgcctcgcaaaacatcgtgccggttacg
ctcgagctgggcggcaagtcaccgaacattttcttcgctgatgtgatggacaaagacgat
gactttcttgataaagcgcttgaaggctttacgatgttcgccttaaaccaaggcgaagtg
tgcacatgcccgtcgcgcgccctcatccatgagtcgatttacgacgcctttatggaacgg
gcgcttgaacgcgtcaagcaaatcaaacaaggcaatccgcttgacacggaaacgatgatc
ggcgcccaagcctcctccgaacagctcgagaaaattttgtcatacatcgacatcggcaaa
caagaaggcgccgaacttttgatcggcggcgagcggaacatgctcgaaggagaactgtcc
ggcggctattacgtcaagccgaccgttttcaaagggcataacaaaatgcgcatcttccaa
gaagaaattttcggcccggtgctcgcggtcacgacgtttaaagatcacgacgaagcgctt
tcgatcgccaatgagacgctgtacggccttggcgccggcgtctggacgcgcgacatcaac
accgcgtaccgcttcggccgcggcatccaggccggccgcgtgtggacgaactgctatcac
atttatccggcccatgcggcatttggcggctacaagatgtccggcatcggccgcgaaacg
cacaaaatgatgctcgaccattaccaacaaacgaaaaacttgctcgtcagctattcgccg
aaaaaactgggcttgttctaa

DBGET integrated database retrieval system