KEGG   Geobacillus lituanicus: GLN3_11520Help
Entry
GLN3_11520        CDS       T05193                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
gli  Geobacillus lituanicus
Pathway
gli00473  D-Alanine metabolism
gli01100  Metabolic pathways
gli01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:gli00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    GLN3_11520
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    GLN3_11520
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:gli01011]
    GLN3_11520
Enzymes [BR:gli01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     GLN3_11520
Peptidoglycan biosynthesis and degradation proteins [BR:gli01011]
 Precursor biosynthesis
  Racemase
   GLN3_11520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ASS88749
UniProt: A0A223E0M1
LinkDB All DBs
Position
2310153..2311319
Genome map
AA seq 388 aa AA seqDB search
MNDFHRDTWAEVDLDAIYDNVANLRRLLPDDTHIMAVVKANAYGHGDVQVARTALEAGAS
RLAVAFLDEALALREKGIEAPILVLGASRPADAALAAQQRIALTVFRSDWLEEASALYSG
PIPIHFHLKMDTGMGRLGVKDEEETKRIAALIERHPHFVLEGVYTHFATADEVNTDYFSY
QYTRFLHMLEWLPSRPPLVHCANSAASLRFPDRTFNMVRFGIAMYGLAPSPGIKPLLPYP
LKEAFSLHSRLVHVKKLQPGEKVSYGATYTAQTEEWIGTIPIGYADGWLRRLQHFHVLVD
GQKAPIVGRICMDQCMIRLPGPLPVGTKVTLIGRQGDEVISIDDVARHLETINYEVPCTI
SYRVPRIFFRHKRIMEVRNAIGRGESSA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaacgactttcatcgcgatacgtgggcggaagtggatttggacgccatttacgacaat
gtggcgaatttgcgccgtttgctgccggacgacacgcacattatggcggtcgtgaaggcg
aacgcctatggacatggagatgtgcaggtggcaaggacagcgctcgaagcaggggcctcc
cgcctggcggttgcctttttggatgaggcgctcgctttaagggaaaaaggaatcgaagcg
ccgattctagttctcggggcttcccgtccagctgatgcggcgctggccgcccagcagcgc
attgccctgaccgtgttccgctccgactggttggaagaagcgtccgccctttacagcggc
cctattcctattcatttccatttgaaaatggacaccggcatgggacggcttggagtgaaa
gacgaggaggagacgaaacgaatcgcagcgctgattgagcgccatccgcattttgtgctt
gaaggggtgtacacgcattttgcgactgcggatgaagtgaacaccgattatttttcctat
cagtatacccgttttttgcacatgctcgaatggctgccgtcgcgcccgccgctcgtccat
tgcgccaacagcgcagcgtcgctccgtttccctgaccggacgttcaatatggtccgcttc
ggcattgccatgtatgggcttgccccgtcgcccggcatcaagccgctgctgccatatcca
ttaaaagaagcattttcgctccatagccgcctcgtacacgtcaaaaaactgcaaccaggc
gaaaaggtgagctatggtgcgacgtacactgcgcagacggaggagtggatcgggacgatt
ccgatcggctatgcggacggctggctccgccgcctgcagcactttcatgtccttgttgac
ggacaaaaggcgccgattgtcggccgcatttgcatggaccagtgcatgatccgcctgcct
gggccgctgccggtcggcacgaaggtgacactgattggtcgccagggggacgaggtgatt
tccattgatgatgtcgctcgccatttggaaacgatcaactacgaagtgccttgcacgatc
agttatcgagtgccccgtatttttttccgccataagcgtataatggaagtgagaaacgcc
attggccgcggggaaagcagtgcataa

DBGET integrated database retrieval system