KEGG   Geobacillus lituanicus: GLN3_12355Help
Entry
GLN3_12355        CDS       T05193                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
gli  Geobacillus lituanicus
Pathway
gli00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:gli00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    GLN3_12355
Enzymes [BR:gli01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     GLN3_12355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ASS87758
UniProt: A0A223DXN2
LinkDB All DBs
Position
2493305..2494786
Genome map
AA seq 493 aa AA seqDB search
MKIQNYINGEWKEPSTGQFAPVINPATGETIAEVAMSGPNDIDEAVQAAKEAQRQWALVP
APKRAEVLYRVGMLLKERKEQLARLLTMEMGKVIEEARGEVQEGIDMAFYMAGEGRRLFG
DTTPSELKDKFAMSVRVPVGVVGIITPWNFPIAIATWKSFPAIVAGNAVVWKPAPETPIM
AQELARIFEEAGLPPGVFHVVHGDGPTVGNALVEHPDVKVISFTGSNEVGRMIAEKCGRL
LKKVSLEMGGKNAVIVMDDADLTLAVDGIIWSAFGTSGQRCTACSRVIVHERVKQELERR
LLEAVKTLKIGNGLDETVKVGPVIHEEALQKIDRYVRIGVEEGAKLLIGGHRLREGDYAR
GFYYAPTIFTDVTPNMRIAREEIFGPVVSIMSVRSLDEAIAVNNSVDYGLSSAIFTRDVN
RVFRAMRDLDTGIVYVNAGTTGAEIHLPFGGTKGTGNGHRDSGVAALDVFTEWRSIYVDF
SGKLQRAQIDTDD
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaatccaaaactatatcaatggagaatggaaggagccaagcaccgggcaatttgcg
ccggtgattaatccggcgacgggggaaacgattgccgaggtggcgatgtccggtccaaac
gatattgatgaggccgttcaggcagccaaagaagcgcaaagacagtgggcgctcgtgccg
gcgccgaaacgcgcggaagttttatatcgagtcggcatgctgctaaaggagcggaaagaa
caattggcacggctgttgacgatggaaatgggcaaggtgatcgaggaagcgcgcggcgaa
gtgcaggaaggcattgatatggcgttttatatggcgggggaagggcggcggctgttcggc
gatacgacgccgtctgagctgaaagacaagtttgcgatgagcgtccgcgtgccggtgggg
gttgtcggcatcatcactccttggaactttccgattgccatcgcaacgtggaagtcgttc
cccgcgattgtggccggcaatgcggtcgtatggaagcccgcgcccgagacaccgatcatg
gcgcaggaattagctcgcatttttgaagaagcgggcttgcctccgggagtgtttcatgtg
gtccacggtgacggaccgacagtcggcaatgcgctcgtcgagcatccggatgtcaaggtc
atctcatttaccggatcgaatgaagtcgggcggatgattgcggaaaaatgcggacgactg
ttgaaaaaagtgtcgctcgaaatgggtgggaaaaacgcggtgatcgtcatggatgatgcc
gatttgacattggcggttgacggcatcatctggagtgcgttcggcacatcaggccagcgg
tgcacggcgtgcagccgggtcatcgtccatgagcgggtgaaacaggagcttgagcggcgt
ctgctggaagccgtgaaaacattgaaaatcggcaacgggttggatgaaacggtcaaagtc
ggacccgtcatccatgaagaggcgctgcaaaagatcgaccgctacgtgcgcattggtgta
gaagaaggggcgaaattgctgattggcggtcatcgactgcgcgagggcgactatgcgcgc
ggcttttactacgcgccgacgattttcaccgatgtcacgccgaatatgcgcatcgcccgc
gaagaaattttcggcccggttgtatcgatcatgtccgtccgcagtttggacgaagcgatc
gccgtcaacaacagtgtcgattacgggctgtcaagcgccattttcacccgcgatgtcaac
cgcgtcttccgagcaatgcgcgatttggacaccggcatcgtatatgtcaacgccggcacg
acaggggcggaaattcatttgccgtttggcggcacgaaagggacgggcaacggccaccgc
gactccggcgtcgcggcgcttgacgtcttcaccgaatggcggagcatttatgtcgatttc
agcggcaagctgcaacgggcgcaaatcgataccgatgattga

DBGET integrated database retrieval system