KEGG   Geobacillus lituanicus: GLN3_13325Help
Entry
GLN3_13325        CDS       T05193                                 

Definition
(GenBank) glycine oxidase ThiO
  KO
K03153  glycine oxidase [EC:1.4.3.19]
Organism
gli  Geobacillus lituanicus
Pathway
gli00730  Thiamine metabolism
gli01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gli00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    GLN3_13325
Enzymes [BR:gli01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.19  glycine oxidase
     GLN3_13325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Pyr_redox_2 HI0933_like NAD_binding_8 FAD_binding_2 Pyr_redox_3 Pyr_redox NAD_binding_9 Thi4 FAD_binding_3 FAD_oxidored Mqo 3HCDH_N GIDA
Motif
Other DBs
NCBI-ProteinID: ASS87906
UniProt: A0A223DY71
LinkDB All DBs
Position
2670116..2671252
Genome map
AA seq 378 aa AA seqDB search
MGAHYDVVVVGGGVIGAATAFELAKRRHRVAIFEKGTMAGEASSAAAGMLGAQSEFAAPS
PLIPLALQSRALMPALAAELRERTGIDIGLVEKGMLKVATNAEEAEELHRHYTFWKEMGE
IVHWLAAEEALKLEPRLAGEALAGAMYIPGDGQVSAPDLAAALVSAAVSAGAHLYEHTEV
FDIRSDAGGHTVETASGTFAAAAVVIASGAWAARLGAALGLPLFVFPVKGECIMVRTPTP
LVQMTVFAKNGCYIVPKRGNRLLIGATSTPGTYDRRVSIAGVMSLLRRAARLLPDVEQAE
WVKAWSGIRPQTKDGLPYIGEHPKRRGIFVAAGHYRNGILLSPLTGRLLADLVERKEPAF
DLSPFSLTRHAEEKVGVE
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgggggcacattatgatgtcgtcgttgtcggcggcggggtgatcggggcggcgacagct
tttgagctcgccaaacggcggcaccgcgtggcgattttcgaaaaaggaacaatggccggc
gaagcgtcaagcgcggcggccggtatgctgggggcgcaatcggagttcgccgcgccgagt
ccgctcatcccgctcgccctgcaaagccgggcgctcatgccggcgctcgctgcggaattg
cgggagagaaccggtattgacatcggacttgtcgaaaaagggatgctcaaagttgcgacg
aatgcggaagaagcggaggagttgcaccgccattatacattttggaaggaaatgggtgag
atagttcactggctggcggcagaagaagcgcttaagctggagccgcgtcttgcgggcgag
gcgctggccggcgccatgtacattcccggagacgggcaagtgagcgccccggatttggct
gccgctcttgtttcagccgccgtctccgccggtgcgcatttgtatgagcatacggaagtg
tttgacattcgttcggatgccggcgggcataccgtggaaacagcgagcggaacgttcgcc
gctgccgctgtcgtgatcgcctcgggcgcctgggcggcgcgtctgggggccgcgctcggg
ctgccgctttttgtattcccggtcaagggggaatgcatcatggtgcgtacgccaaccccg
ctcgtgcaaatgacggtgtttgcgaaaaatggctgttacatcgtgccgaagcgcggcaac
cggctgctgatcggtgcgacgtccacgccggggacgtacgaccggcgcgtgtcaatcgcg
ggggtgatgagcctgcttcgccgtgccgcccgtctgcttccagatgtcgaacaggcagaa
tgggtgaaggcatggagcggcatccgaccgcaaacgaaagacggtttgccctatatcggc
gagcatccaaagcggcgcgggatatttgtcgctgccggccattaccggaacggcattttg
cttagcccgctcaccggccggctgcttgccgacctagtagagcggaaagagccggcgttt
gacttgtcaccgttttcattaacgcgtcacgcggaagaaaaggtgggggttgaatga

DBGET integrated database retrieval system