KEGG   Gloeobacter kilaueensis: GKIL_0043Help
Entry
GKIL_0043         CDS       T02885                                 

Gene name
gutB
Definition
(GenBank) alcohol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
glj  Gloeobacter kilaueensis
Pathway
glj00040  Pentose and glucuronate interconversions
glj00051  Fructose and mannose metabolism
glj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:glj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    GKIL_0043 (gutB)
   00051 Fructose and mannose metabolism
    GKIL_0043 (gutB)
Enzymes [BR:glj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     GKIL_0043 (gutB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 Pyr_redox_2 PALP FeoA NCD3G
Motif
Other DBs
NCBI-ProteinID: AGY56290
UniProt: U5QF24
LinkDB All DBs
Position
complement(43178..44212)
Genome map
AA seq 344 aa AA seqDB search
MRAALLYGQQDVRLEEVSTPIAAAGEVLVQVAVAPTCGTDLKVWLRGGHARMLTPPTPFG
HEFAGTILAVGEGVSSWQPGERVVANNSAPCFECFYCRRERYSLCENLLFHNGTFAEIVC
LPAAIVRHNLLAVPDGLPLELAAMSEPLACVLHGVEEAGVVPGDQVVVMGDGAIGLMLVA
VCALRGATVILSGGQTSRLALGRQLGAGAVLNYRESPDPVVSLRKLANDGRGADVVIEAT
GSPAAWQMAIAAARPGATVLLFGGCPRGTSIAVDTENLHYNELTLKGVFHNTPRHLREAL
ALLASRQLPFELLISDRLPLAKLNTALERMRDRTAVKVAILPGD
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgcgagcagcgctgctctacggtcaacaggacgtgcgtctggaggaagtatcgacgccg
atagcggcggcgggggaggtactggtgcaggtggcggtcgccccaacctgcggcaccgat
ctcaaagtctggttgcggggcggccatgcccggatgctgacgccgcccaccccttttggc
cacgaatttgctgggacgatcctggcggtgggcgaaggggtgagcagctggcagccaggc
gagcgggtggtagccaacaactctgccccctgcttcgagtgcttttattgtcggcgcgag
cgctacagcctgtgtgaaaatctgctctttcacaacggcaccttcgctgagatcgtctgt
ttgccggcagcgatcgtccgccacaatctactcgctgtgcccgatggattgccgctggag
ctggcggcgatgagcgagccgctcgcctgcgtgctgcacggcgtcgaggaggccggggtg
gtccctggcgatcaggtggtcgtgatgggcgacggggcgatcggtctgatgctggtggcc
gtctgtgccctgcgcggggcaacggtcatcctctcggggggccagacgagccgtctggct
ctgggcaggcagttgggggcaggcgcggttctcaattatcgcgaaagccccgatccggtt
gtctctttacgcaaactggccaacgatggtcggggagcggacgtggtcatcgaggcaacc
ggctcgcctgctgcctggcagatggcgatcgccgccgcccgccctggggcgacggtctta
ctttttggcggttgtccacgcggtacctcgatcgcggtggacaccgagaacctgcactac
aacgagctgacgctcaagggcgtctttcacaacacaccgcgccacctgcgcgaggcgctg
gcattgcttgcttcgcggcagttgcccttcgagctgctcatcagcgaccggctgccgctg
gcaaaattaaacacggctctggagcggatgcgcgaccgcaccgctgtcaaagtggcgatc
ctgcccggcgactga

DBGET integrated database retrieval system