KEGG   Gloeobacter kilaueensis: GKIL_0930Help
Entry
GKIL_0930         CDS       T02885                                 

Gene name
thiO
Definition
(GenBank) glycine oxidase ThiO
  KO
K03153  glycine oxidase [EC:1.4.3.19]
Organism
glj  Gloeobacter kilaueensis
Pathway
glj00730  Thiamine metabolism
glj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:glj00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    GKIL_0930 (thiO)
Enzymes [BR:glj01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.19  glycine oxidase
     GKIL_0930 (thiO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Pyr_redox_3 Pyr_redox_2 NAD_binding_8 Pyr_redox FAD_binding_2 FAD_binding_3 HI0933_like ApbA PMSR TrkA_N AlaDh_PNT_C UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: AGY57176
UniProt: U5QE27
LinkDB All DBs
Position
complement(951807..952859)
Genome map
AA seq 350 aa AA seqDB search
MKIVILGGGIVGLALAIELHRIGATQVLVLDRGHSPATWAAAGMIAPRAEGLRGALLDLG
LASRALWPAWAAQLEEASGEPVDYRSCGVLLPAQNKEAVEKQNIALGEGCWWEREEVLAH
IPGICETIAGGLWFEKEGAVDNRRVLVALRAAAERLGIAVQSGVNVLGPADPDLRAVTTD
AGLVSADRFVLAQGAWSGTWLDLPVQPLKGQMLALKSQPEQLRTVLYGEGVYLVPRRDGR
IVVGATQEQVGFEPGNTAAGIHALLTNALALVPGLADCPLVEQWWGFRPATPDAAPLLGQ
GPWPHLHLATGHHRNGILLAPITARLLAREIVTGEPQPLLAPFSYRRFCP
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaatagtcattttgggcggtgggattgtcggcctcgccctggccatcgagttgcac
aggatcggagcgacgcaagtgctcgtcctcgatcggggccattcaccggccacctgggcg
gcggcagggatgatcgccccacgggcggaagggctgaggggtgcgctcctggatctggga
ctggcgagccgggcgctctggcccgcctgggccgcccaattagaagaagcgagcggtgag
ccggtcgattatcgcagctgcggcgtcctgttgcctgcccagaataaagaagcagtcgaa
aaacagaacatcgccctgggcgagggatgctggtgggaacgcgaggaggtactggcccac
atccccggtatctgcgaaaccattgcaggcgggctctggtttgaaaaagaaggcgcagtc
gataatcgccgggtgctcgtcgctctgcgggcggcggctgaacggctggggatcgcggta
cagtcgggagtgaacgtccttggcccggcagatccggacctgcgggcagttactaccgac
gccgggctcgtcagcgccgatcggttcgtgctcgcccagggagcctggtccggcacctgg
ctcgatctaccggtccagccccttaaaggccagatgctcgctcttaaaagtcagccggag
cagttgcgcacggtgctctacggcgagggcgtctatctggttcctcgccgggacgggcga
atcgtcgtcggtgccacccaggagcaggtgggcttcgagccgggcaataccgccgccggc
atccacgccctgctcacaaacgccctcgccctggtgcccggtctggccgactgtccgctc
gtcgaacagtggtggggcttccggcccgccacccccgacgctgcccccctgttgggccag
gggccgtggccacacctgcatctggccaccggccaccaccgaaacggcattctccttgcg
ccgattaccgcccgcctgctggcccgcgagattgtcaccggcgagccgcaaccgctgctc
gcccccttcagctaccggcgcttttgcccgtga

DBGET integrated database retrieval system