KEGG   Gloeobacter kilaueensis: GKIL_1557Help
Entry
GKIL_1557         CDS       T02885                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
glj  Gloeobacter kilaueensis
Pathway
glj00620  Pyruvate metabolism
glj00680  Methane metabolism
glj00710  Carbon fixation in photosynthetic organisms
glj01100  Metabolic pathways
glj01120  Microbial metabolism in diverse environments
glj01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:glj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    GKIL_1557 (ppc)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    GKIL_1557 (ppc)
   00680 Methane metabolism
    GKIL_1557 (ppc)
Enzymes [BR:glj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     GKIL_1557 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AGY57803
UniProt: U5QG24
LinkDB All DBs
Position
1592590..1595403
Genome map
AA seq 937 aa AA seqDB search
MNWDSPIDLATAGSPAALSHQSLRENIELVEQLLRQVAFQEGGSELVELLERLWASQDGS
EEGLALIRALSLEQSVLAIRAFSIYFQLINIVEQHHERKLLRLQASFSADTAQPGSFCWL
FDELKSLGISSPEIERVLQQLDVRLVFTAHPTEIIRRTIRTKHRRIANLLDELDGALSEW
QQQQLRADILEVIQLWWRTDELHQVRPTVLDEVAHTVHYFEEVLFETLPRVRAELTRCLA
QFHPALTRSVGTFCRFGSWVGADRDGNPSVTALITWKTACYQRGVVLGKYLHSIERLRDR
LSVADSPPQDLILSLEEDQRALGEVYERYAIVYRQEPYRLKLSFILARLKRTRERNCWLE
EHGPQRLSQPDDPSWQHYYRDASEFLAELQLVQQCLRLTGLVCRELEMLIEQVGAFGFHL
AHLDIRQDSARHEETLSEVASRLRLLDKAYEDLSEIERREWLVRELQTLRPLIPAELPFS
ARTEETIQTFRMIRRLQKEFGTDICNTYIISMSRQASDLLEVLLLAEEAGLFDPATGTGS
LMVVPLFETIEDLRSAPEVLEQLFALPLYRCYLTCHGNLQEVMLGYSDSNKDSGFLASNW
EIFQAQQHIEQVARRHGVQLRIFHGRGGSVGRGGGPAYQAILAQPDGTVSGRIKITEQGE
VLASKYSLPELAAFNIETVVAAVVQASLLPASPPGSRSWELRMQELSDVARRTYRELIYE
QEGFIDFFCHVTPIDEIAQLQISSRPARREGRRDLASLRAIPWVFSWTQSRFLLPSWYGV
GTALAGFIDCNYERNLAELRSMYRNWPFFRAALSKVEMTIAKVDLGLARHYVQELLPEEY
VPAGRRIFRLIESEFERTEDALLLIAEHRHLLEDNPPLQRSIALRNASIAPLGYLQAILL
KYLRGTARTAHSYSRSELLRGALLTINGIAAGMRNTG
NT seq 2814 nt NT seq  +upstreamnt  +downstreamnt
gtgaactgggactcgccgatcgatcttgccactgctggttcgcccgcagcgctctcccac
cagtcgttgcgcgagaatatcgagctggtggagcaattgctcagacaggtggccttccag
gaaggtggcagcgaactggtcgaattgctcgaaaggctctgggcatctcaagacggcagc
gaggaagggctggcgctcatccgggcgctgtcgctcgaacagtcggtgctcgccattcgc
gccttctcgatctactttcagctcatcaacatcgtcgagcagcaccacgagcgcaagctg
ttgcggctgcaggcgagcttcagcgccgatacggcccagccgggctcgttttgctggttg
ttcgatgaactgaagagcctgggcatctcaagtcccgagatcgagcgcgtcctccagcag
ctcgacgtgcggctggtcttcaccgcccaccccaccgagatcatccggcggacgatccgc
accaagcaccgccggattgccaatttgctcgacgaactggatggtgccctctcggagtgg
cagcagcagcagctgcgcgccgacattctcgaggtgattcagctgtggtggcgcaccgac
gaattgcatcaggtgcggccaacggtgctcgacgaagttgcccacaccgtccattacttc
gaggaggtgctctttgagacgttgcccagggtaagggccgaactgacgcgctgtctggcc
cagtttcatccggctctcacccgctcggtcggcaccttctgtcgctttggctcgtgggtg
ggggccgaccgcgacggcaacccttcggtcaccgccttgatcacctggaagacggcctgc
taccagcgcggcgtcgtgctgggcaaatacctgcacagtatcgagcggttgcgcgaccgg
ctgagcgtggccgacagtccgccccaggatctgatcttgtcgctcgaagaggaccaacgc
gctctgggcgaggtctacgagcgctatgcgatcgtttaccggcaggagccttaccgcctc
aagctctcgtttatcctggcgcggctcaagcgcacccgcgagcgcaactgctggctggag
gagcacgggccgcagcgcctgagccagccggacgatccgtcctggcagcactactaccgc
gatgcgtcagaatttttggcggaactgcagctggtgcagcagtgcctgcggctgacgggg
ctggtctgccgcgagctggaaatgttgatcgagcaggtgggagcgttcggctttcacctc
gctcacctcgacatccgccaggacagcgcccgccacgaggagacgctctcagaagtggcc
tcccgcctgcgcctgctggataaagcctacgaggacttgtcggagatagaaaggcgcgag
tggctggtgcgcgagctgcagacgctgcgtccgctcatcccggcggagctaccgttctcg
gcgcgcaccgaagagacaatccagaccttccggatgatccggcggctgcaaaaggagttc
ggcaccgacatctgcaacacctacatcatctcgatgagccgccaggcgagcgacctgttg
gaggtgctgctcttagccgaagaagccgggctttttgatccggcgaccggcaccggcagt
ctgatggtcgtgcccctgtttgagaccatcgaagatctgcgcagcgccccggaggtgctg
gagcaactttttgccctgccgctgtatcgctgttacctcacctgccacggcaacctgcag
gaggtgatgctgggctactccgactccaacaaagattccgggtttctggcaagcaactgg
gagatcttccaggcccagcagcacatcgaacaggtcgcccgccgccacggcgttcaattg
cgaatctttcatggccggggtggttctgtgggccggggcggtggaccggcctaccaggcg
attctggcccagcccgacgggacggtgagtggccgcatcaagattaccgagcagggcgaa
gtgctcgcctccaagtactcgcttcccgaactggcggcttttaatatcgagacggtggta
gcggcggtggtgcaggcgagtctgctgccggccagcccccccggcagccgcagctgggag
ttgcggatgcaggagttgtcggatgtcgcccgccgcacctaccgcgagctgatctacgag
caggaaggctttatcgactttttctgccacgtcacccccatcgacgaaattgcccagttg
cagatcagctcccgccccgcccgccgcgagggccgccgggatctggcgagtctgcgggcg
attccctgggtcttttcctggacccagagccgctttttgctgccctcctggtacggcgtc
ggtacagccctggctggcttcatcgactgcaactacgagcgcaacctggcggagttgcgg
tcgatgtaccgcaactggcctttctttcgcgctgccctctccaaagtcgagatgacgatc
gccaaggtcgatctgggcctggcccgccactacgtccaggagttgctgcccgaggagtac
gtcccggcaggccggcggatcttccggctcatcgagagcgagttcgagcgcaccgaagac
gccctgttgctcatcgccgaacaccggcacctgcttgaggacaacccgcccctgcagcgc
tcgatcgccctgcgcaacgcttcgattgcgcctttaggctacttgcaggcaatcttgctc
aagtacctgcgcggtacggcccgcaccgcccattcctactcgcgcagcgagctgttgcgc
ggcgcactgctgacgatcaacggcatcgccgccggaatgcgcaatacgggctga

DBGET integrated database retrieval system