KEGG   Gloeobacter kilaueensis: GKIL_4247Help
Entry
GKIL_4247         CDS       T02885                                 

Definition
(GenBank) glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
glj  Gloeobacter kilaueensis
Pathway
glj00500  Starch and sucrose metabolism
glj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:glj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GKIL_4247
Enzymes [BR:glj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     GKIL_4247
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: AGY60493
UniProt: U5QNP0
LinkDB All DBs
Position
complement(4465931..4468318)
Genome map
AA seq 795 aa AA seqDB search
MVKFRGEQRAFGPPGIEPRWTAGSKDAVGTAYSSPSRIWFTLWRGILTETYFPTVDTPQI
RDLQFLISDGKSFLHEEKRHLQPTIECLGQGLGYRTTNRDSEDRYRIVKEIIADPHLPCI
LQHVQLLGEEDFVSQLRLYALCSPHLKVSGWGNNAYVVSVAGQDLLVCQKGNTWLAMGAT
VPFCRLSCGYVGTSDGWTDLAANFEMNWQFDQAIDGNVALTGELDLSERREFTLGLAFGH
SLNNAATVLLQSLSLPFAEQLQRFIEQWERPYRHILPLDGSAKDGGKLYRNSYGILLAHE
DKSNSGALIASLAIPWGEAKGEDDTGGYHLVWPRDMVNSATALLAAGNRDTPLRALIYLA
AVQREDGGFSQNFWIGGQTYWQGLQLDEVSFPILLAWRLRRADALQGFDPCAMVLEAAGC
LIRKGPATGQERWEEAGGLSPSTLATNIASLICAASFARERQDEASARFLEEYADYLESH
LEAWTATNAGTLVPGIRRHYIRIQPVGGAPLSVDLEGKRLGLANQKPGDEAAYPASTIVD
AGFLELVRYGIRRADDPLIVDSIKVVDAVLKVETPMGPVWRRYNHDGYGQRDDGGPFTGW
GTGRAWPLLTGERGHYELAAGGDVQSYLQALEAFASPAGPLPEQVWDAPDLPQAHLHLGK
PTGSAMPLAWAHAEYIKLLRSTHDGEVFDLIPEVRDRYQGERASCHRLEIWKPAWQIAAI
KAGDTLRILQDGRAFRVHWSADEWQSVQDTPSVSTALGIAFADLPTSQGGETLRFTFFWI
ASNQWEGRDYAVQVI
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaatttcgcggcgagcaaagggctttcgggccgccagggatcgagcctcggtgg
actgccggcagcaaggacgcggtgggaaccgcctactccagtcccagtcgcatctggttt
acgctctggcggggcattctcaccgagacgtactttccaaccgtcgatacgccccagatc
cgcgatctgcaatttctcatcagcgacggcaaaagctttttgcacgaggagaagcgccac
ctgcagccgacgatcgaatgtctgggtcagggccttggctatcggaccaccaaccgcgac
agcgaggaccgctaccggatcgtcaaagaaatcatcgccgatccgcacctgccctgcatc
ctgcagcacgtgcagctgttgggcgaggaggattttgtctcacagctgcgcctgtacgcc
ctctgctcgccccacctgaaggtgagcggctggggcaacaacgcctacgtcgtgagcgtc
gcaggccaggatctgctcgtctgccagaagggcaacacctggcttgcgatgggagcgacg
gtgcccttttgccgcctctcctgcggctacgtcggcaccagcgacggctggacggacctt
gcggccaactttgagatgaactggcagttcgatcaggccatcgacggcaacgttgccctc
acaggtgagcttgatttaagcgagaggcgggagtttaccctgggccttgcctttggccac
agcctcaacaacgccgccaccgtactgctgcaatctttgagcctgcccttcgctgagcag
ttgcagcgcttcattgaacagtgggagcggccctaccgacacattctgcccttagatggg
tcggccaaggacggcgggaagctctaccgcaacagctacggcattctgctcgcccacgag
gacaagtccaactccggcgcgctcatcgcctccctcgccatcccctggggcgaggccaag
ggcgaagatgacaccggcggctatcacctcgtctggccgagggacatggtcaactccgcc
accgctctgctcgctgccggtaaccgcgacacgcccctgcgggcactgatctatctggcg
gcggtccagcgcgaggacggcggcttttcacaaaatttctggatcggcggccagacctac
tggcaggggctgcaactggacgaggtgtcttttccgatcctgcttgcctggcggctcagg
cgcgccgacgccctgcagggcttcgacccgtgcgcgatggtgctggaggcggcgggctgc
ctgattcgcaagggaccggccaccgggcaggagcgctgggaggaggcggggggtctgtca
ccttctaccctcgccaccaacatcgcttcgctcatctgtgcggcgagttttgcccgcgag
cggcaggacgaggcgagtgcgcgctttttagaagaatacgccgactacctggagagccac
ctcgaagcctggacggcgacgaacgcgggcacgctggtgccgggtatccgccgccactac
atccgcatccagccggtaggcggcgcaccgctgagcgtcgatctggagggcaagcggctc
gggcttgccaatcaaaagcccggcgatgaggcagcgtatccggccagcacgatcgtcgat
gcgggctttctggagctggtgcgctacggcatccgccgggccgacgacccgctcatcgtc
gattcgatcaaggtcgtagacgccgtacttaaagtcgagacgccgatgggaccggtctgg
cggcgctacaaccacgacggctacggtcagcgagacgacggtggaccgtttacaggctgg
ggcacgggccgggcctggccgcttttgaccggcgagcggggccactacgaactggcggcg
ggcggcgatgtgcagagctatctccaggcgctggaggcgttcgcttcgccagctggtccc
ctgcccgagcaggtctgggacgcgccggatctgccccaggcgcacctgcacctgggcaaa
ccgaccggctcggcgatgcccctcgcctgggcgcacgccgagtacatcaagctgttgcgc
tcgacccacgacggcgaggtgttcgatctgatcccggaggtgcgcgaccgctaccagggc
gagcgcgcctcctgccaccgcctggagatctggaagcccgcctggcagattgctgcgatc
aaggcgggcgacaccctgcgcatcctgcaggatggcagagccttccgggtacactggtcc
gccgacgagtggcagagcgtccaggacaccccttctgtgagtacggccctgggcattgcc
ttcgccgatctgccgacaagccagggtggagaaacgctgcgatttactttcttctggatc
gcgagcaatcagtgggagggccgcgactacgcggtgcaagtaatttag

DBGET integrated database retrieval system