KEGG   Geobacter lovleyi: Glov_0959Help
Entry
Glov_0959         CDS       T00708                                 

Definition
(GenBank) Pyridoxal-dependent decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
glo  Geobacter lovleyi
Pathway
glo00250  Alanine, aspartate and glutamate metabolism
glo00410  beta-Alanine metabolism
glo00430  Taurine and hypotaurine metabolism
glo00650  Butanoate metabolism
glo01100  Metabolic pathways
glo01110  Biosynthesis of secondary metabolites
glo01120  Microbial metabolism in diverse environments
glo02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:glo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Glov_0959
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Glov_0959
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Glov_0959
   00430 Taurine and hypotaurine metabolism
    Glov_0959
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Glov_0959
Enzymes [BR:glo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     Glov_0959
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS
Motif
Other DBs
NCBI-ProteinID: ACD94682
UniProt: B3E5L1
LinkDB All DBs
Position
995209..996825
Genome map
AA seq 538 aa AA seqDB search
MPTKARANLETLYRIFTVPEAPDSTLGAVDQAITADVAGFLQNHIVAMERPLEEIEASFS
SVTIPEEPTYVSDYTEFVKENLVAQSVHTASPGFIGHMTSALPYFMLPLTRLMTALNQNT
VKVETSKAFTPLERQVLAMLHHLIYRCPDEFYPSWIHNSQAALGAFCSGGTIANTTALWV
ARNRFFAPDGAFRGIAQEGLARALKHRGVDGIAVLVSERGHYSLGKAADLLGVGRDHLVK
VKTAEDNRIDLKALRQECQRLQDQNIRPLALVGIGGTTETGNIDPLEAMADLARELDCHF
HVDAAWGGPTLFSDRHRHLLAGIERADSVTIDAHKQLYVPMGAGMVLFRDPTAVSAIEHH
AAYILRHGSKDLGSHTLEGSRPGKALLVHAGLSIMGRKGYELLIDLGIERARTFAGMIRQ
HPDFELTSEPELNILTYRYCPAAIQHLLATAPQAEQARINGLLDQVCQLLQKHQRESGKT
FVSRTRLRMSRYGEEITVLRSVLANPLTTDEILTSVLSEQCEIVRQPEIQALLQQVWR
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgcccaccaaggcccgtgccaacctggaaaccctttaccggatcttcaccgtgccggaa
gcccctgattcaacccttggtgccgttgaccaggctattactgccgatgtggccgggttt
ctgcaaaaccatatcgtggccatggagcgtcccctggaggagattgaggccagcttctcc
agcgtgaccatcccggaggaaccgacctacgtctcggactacaccgaatttgtcaaagaa
aacctggtggcccagtcggtacataccgcctcacccggatttatcggccacatgacctcg
gccctgccctactttatgctgccgctcacccgcctgatgaccgcgctgaaccagaacacg
gtcaaggtcgagacctccaaggcctttaccccgcttgagcggcaggtactggccatgctg
catcacctgatctaccgctgtccggacgagttctacccttcctggatccacaacagccag
gcagcactgggggccttctgctccggtggcaccattgccaataccaccgcactctgggtg
gcccgcaatcgcttctttgcgccggatggtgctttccgcggtattgcccaggaggggctg
gcccgcgccttgaaacatcgtggtgttgacgggatcgctgtgctggtttccgagcggggg
cattactcgctgggcaaggctgccgacctgttgggtgtcggccgtgaccatctggtcaag
gtcaagaccgcagaggacaaccggatcgacctcaaggcgttgcggcaggagtgtcagcgc
ctgcaggatcagaacatccggccgctggcgctggtggggattggcgggaccaccgaaacc
ggcaacattgacccgctggaggcgatggccgatcttgcccgggagctggattgccatttc
catgtggatgcggcctggggcggtccgacgctcttctctgaccgccaccgccatctgctg
gccgggatcgaacgggccgactcggtaactattgacgcccataagcaactgtatgtaccg
atgggggcggggatggtgctcttcagggatcccaccgcagtatccgccatcgagcatcac
gctgcctacatcctgcgccatggttccaaggatctgggcagtcacaccctggaaggctcc
cgtccgggtaaggcgctgctggttcacgccgggctctcgatcatggggcgtaaagggtat
gaactgttgatcgatctggggatagagcgggcccggacctttgccgggatgatccgccag
catccggattttgaactgaccagtgagccggaactgaatatcctgacctaccgctactgt
ccggcagcgattcagcacctcctggcaaccgcaccacaagcggagcaggccaggatcaat
ggtttgctggatcaggtctgccagctattgcagaaacaccagcgtgagtcgggcaagacc
ttcgtgtcccgtacccggctccggatgagccggtacggcgaggagatcaccgtgctgcgc
agcgtgcttgccaacccgcttaccaccgatgagattctgacgtcggtgctgagcgaacag
tgcgagattgtccgtcagccggagatccaggccctgctgcaacaggtctggaggtag

DBGET integrated database retrieval system