KEGG   Geobacter lovleyi: Glov_2492Help
Entry
Glov_2492         CDS       T00708                                 

Definition
(GenBank) penicillin-binding protein 2
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
glo  Geobacter lovleyi
Pathway
glo00550  Peptidoglycan biosynthesis
glo01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:glo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Glov_2492
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    Glov_2492
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:glo01011]
    Glov_2492
Enzymes [BR:glo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Glov_2492
Peptidoglycan biosynthesis and degradation proteins [BR:glo01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   Glov_2492
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: ACD96206
UniProt: B3E5W5
LinkDB All DBs
Position
complement(2663984..2665906)
Genome map
AA seq 640 aa AA seqDB search
MIKVQRYVREVAQPRQRTIPLAIVVTVLFFLLLLRLWYLQIIRVDDYRAMSENNRLRFLP
VAASRGALMDRNGTVMVNNRPSFSLSIIPQEVKDVEGMLDKLASLLKLDKAELQERWEKS
KGRARYYPVVIAVNISREQVEIVEENKLWLPGVEVSVKPVREYAFQNSGAHLLGYIGEIS
DKELDLPAYGDYNPGDYIGKNGIEKAWESELHGSDGGRQLEVDSRGRVLRVLSESSPTVG
NSLVLTVDSRLQRTAEQAFGGQAGAAVVMNVNNGEVLAFVSSPTFDPSLFAGRIPADIWK
GYLEDKRHPLENKALSGQYPPGSTFKMLTALAGLEAGVVNENTSVYCDGAYEMGGSKFRC
WSKSGHGSVNLRKSLKESCDVYYYQLGEKLGVDRIAAMAERFLLGREMGIGLQNEKKGLI
PTSAWKLKRFGKKWFPGETLPVAIGQGYLLMTPIQLASMVATVANEGTIYRPHLVKRVVD
PDGKTIKEFSPEVLGTTGISPASFKKVKQGLFAVVNDPGGTGANARLWDVKVAGKTGTSQ
VVKLGEDRKKAVAYQYKDHGLFVAFAPFDKPEIAVAVVVEHGGGGGAVAAPIAGRILRNY
FDLQKPPAPRQKTEDAPQDESQAETPVKKLESQAQQGADE
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaagtgcagcgttacgtcagagaagtcgcccagcctcggcagcgtaccattccg
ttggccattgtggtgacggtgctgtttttcctgcttttgttgcgcctctggtacctgcag
atcatcagggttgacgactaccgggccatgtcggaaaataaccggctgcgttttctgccc
gttgctgcctctcgcggtgccctgatggatcgtaacggcaccgtcatggtcaataatcgc
ccctccttcagcctgtcgatcattccccaggaggtcaaggacgtcgaggggatgctggat
aagctggcatcgctcctgaagctggataaggccgaattgcaggagcgctgggagaagtca
aaagggcgcgcccgctattacccggtcgtgattgcggtcaacatcagccgcgaacaggtc
gaaattgtcgaagaaaacaagttgtggctgcccggtgtggaggtcagtgtcaagccggtt
cgcgagtacgcctttcaaaattcgggtgcgcatctgttgggctatattggcgaaatatct
gataaagagttggatttgccggcctacggcgactacaatccgggcgactatatcggtaag
aacggcatagaaaaggcatgggagagtgagctgcacggcagtgacggaggccgtcagctt
gaagtggactcacgggggcgcgtcctgcgggtgctgagcgagagcagccccacggtggga
aacagcctggtcctgacggttgacagccgcctgcagcgtacagcagagcaggcgttcgga
gggcaggccggcgctgcggtggtgatgaatgtcaacaacggtgaagtgctggcctttgtc
agtagcccgacctttgacccgtcgctctttgccgggcgtattccggctgatatctggaag
gggtatctggaagataaacggcatcccctggaaaacaaggccctgtccggccagtatccg
cccggttccacctttaagatgctgaccgccctggcaggccttgaagcgggggtggttaat
gaaaatacaagcgtatactgtgacggtgcctatgaaatggggggcagcaaattccgctgt
tggagcaagtccggccatggcagcgtgaacctgcgtaaatcactgaaagaatcctgcgac
gtctactactatcagctgggggaaaaactgggggtggaccggattgccgccatggcggag
cgctttctgctggggcgtgagatgggtatcgggctgcagaatgagaaaaaagggctgatt
cccacttcggcctggaaactgaaacgtttcggcaaaaagtggtttcccggcgagaccctg
ccggtggccatcggccagggttatctgctgatgaccccgattcagctggcctccatggtg
gcgacggttgccaatgaagggaccatctaccgtccacacctggtcaagagggtcgttgac
ccggacggcaagaccatcaaggagttcagcccggaagttctgggaaccaccggcatctct
ccggcttcatttaaaaaagtgaaacagggcctctttgccgttgtcaacgatcccggcgga
accggtgccaatgcccgtctgtgggatgtgaaagtggccggcaagaccggtacgtcgcag
gtggtaaaactgggggaggaccgtaagaaggcggttgcctaccagtataaggaccatggc
ctgtttgtggcctttgccccctttgacaaaccggagattgcagtggccgtggtagtggaa
catggtggcggcggcggcgcggtggcggctccgattgccggcaggattctgcgcaactat
tttgatttgcagaaacccccggcgcccagacagaagacagaagatgcgccgcaggatgaa
tcccaggccgagaccccggtcaaaaaactggaaagccaggcgcaacagggggctgacgag
tga

DBGET integrated database retrieval system