KEGG   Geobacter lovleyi: Glov_2687Help
Entry
Glov_2687         CDS       T00708                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
glo  Geobacter lovleyi
Pathway
glo00564  Glycerophospholipid metabolism
glo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:glo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Glov_2687
Enzymes [BR:glo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Glov_2687
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored NAD_binding_8 HI0933_like GIDA Pyr_redox_3 Pyr_redox_2 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ACD96400
UniProt: B3E6Z5
LinkDB All DBs
Position
complement(2886048..2887604)
Genome map
AA seq 518 aa AA seqDB search
MKRAKLLQQLEDGPLWDMIVIGGGATGLGTAVEAASRGYRTLLLEQGDFAQGTSSRSTKL
IHGGVRYLQQGNLSLVLEALRERGLLIRNAPHLVHNMSFVVPLYDWWEGSFYGIGLKMYD
LLAGKLGLGPSCLLSKEETLRHIPTVEPSGLRGGVIYHDGQFDDSRLAISLALTLADLGG
VALNYLAVTNIIRTDGLVSGLTALDRETGREFAIRGKVVINAAGPFIDKVRRMVDPTLKE
LITPSQGVHLVLDGSFLNGDSAIMVPHTDDGRVLFAVPWHGRTIVGTTDTPIPEAGLEPR
PLAEEIDFLLAHASRYLTRHPQRSDLLSIFAGIRPLVRADAGSDTASLSRDHTLLVESSG
LITIAGGKWTTYRKMGEDTVTAAAQIAGLEERPSVTAELRIHGWQEGVAGDRPLQVYGSD
AAALEQLLAENPAWREPLHPALPYCAGEVIWGTRCEQARTVEDILARRTRALLLDARASI
SAAPQVAALMASELGQDQTWQEAQVAAFTELACGYLPV
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtgcgaaactgctgcagcagcttgaagatggcccactctgggatatgatcgtg
atcggcggcggcgccaccggccttggcacggccgtggaggcggccagccgcggctaccgg
accctgctgctggaacagggggattttgcccagggaacctccagccgaagcaccaaactg
atccatggcggggtgcgctacctgcagcagggcaacctgtcgctggtgctggaggcgctg
cgggagcggggactgctgatccgtaacgccccccatctggtgcataacatgtcgtttgtg
gtgccgctctatgactggtgggaagggtcgttctacggtatcggccttaaaatgtacgac
ctgctggccggtaagctggggctcggcccctcctgcctgttgtcaaaggaagagaccttg
cgccatatccccaccgtggagccgagcggtctgcggggcggggtgatctaccatgacggc
cagtttgacgattcccgtctggccatcagtctggccctgaccctggccgatctgggcggt
gttgcgctcaactacctggcggtgaccaacatcatccgtacagacgggctggtgagcggg
ctaacggcgctggacagggaaacgggccgggaatttgccatcaggggcaaggtcgtcatc
aacgctgccggtccgttcatcgacaaggtgcggcggatggttgatcccaccctcaaagag
ctgattacccccagccagggcgtgcatctggtgctggacggctcgttcctgaacggtgac
agcgcaatcatggtgccccataccgatgacggccgggtgctgtttgcggtcccctggcat
ggccgtaccattgtcggtaccaccgataccccgattccggaggccggactggaaccgcgt
ccgctggcggaagagatcgactttctgctggcccatgccagccgctatctgacccgccac
ccgcagcgttccgacctgctgagcatctttgccggtatccggccgctggtccgtgccgat
gcaggcagcgacaccgcttcgctctcccgcgaccacaccctgctggtggagagcagcggt
ctgatcaccattgccggtggcaagtggaccacctaccgcaagatgggggaggatacggtt
actgcagcggcccagatcgccgggctggaggagcgaccatcggttaccgccgagctgcgg
attcatggctggcaggaaggggtagccggtgaccggcccttgcaggtctacggcagcgat
gccgcagcactggaacagctgctggcggaaaacccggcctggcgggaaccgctgcatccg
gcgctgccctactgtgcaggggaggtgatctggggaacacgctgtgaacaggcacggacc
gtggaggatatcctggcccgccgcaccagggcgctgctgctggatgcccgcgccagtatc
agcgcggcgccgcaggttgcggcactgatggcgtccgagctggggcaggaccagacctgg
caggaggcgcaggtggcggcattcacggagcttgcctgcggctacctgccggtgtga

DBGET integrated database retrieval system