KEGG   Geobacter lovleyi: Glov_3322Help
Entry
Glov_3322         CDS       T00708                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
glo  Geobacter lovleyi
Pathway
glo00500  Starch and sucrose metabolism
glo01100  Metabolic pathways
glo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:glo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Glov_3322
Enzymes [BR:glo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     Glov_3322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphorylase DUF3417 Sdh5 Capsule_synth
Motif
Other DBs
NCBI-ProteinID: ACD97028
UniProt: B3EBI9
LinkDB All DBs
Position
complement(3552581..3555145)
Genome map
AA seq 854 aa AA seqDB search
MDFSKLLHKFTVVPSLSDELAPLQRIAYNLWWSWDPDAIALFKRLDIDLWNATRHNPVEM
LGILQQTTLESLKQDEGFMAHLQMVDEKLTAYMSEKSWFQKEYNGDAELKTAYFSMEFGL
HESLAVYSGGLGILAGDHLKSASDLGLPLVGVGLLYRQGYFRQYLNNEGWQQEIYPENDF
YNLPLILERDQLGRPFEVELEFGPRHFKAHIWRVQVGRVPLYLLDTNLEENNPEDRLITS
QLYGGNQEMRMLQEILLGIGGVRALRALRIIPNVCHMNEGHAAFLALERIRLVMEKRKIS
FNEAREVTRAGNIFTTHTPVEAGIDHFPTEMLDKYFTKYIRSFNLSRDEFLGLGRQNPAD
QYESFCMAVLALKLAGHANGVSQLHGEVSRSMWKNLWPELPEEQLPLSSITNGVHTRTWM
SGQMGSLLVRYLGTRWLDDPTDHNVWRRIGKIPDAEIWRTRQSTRERLVDFARCRLKEQL
KKVGATAKEIATADEVLDPEVLTIGFARRFATYKRGTLLMRDLDRLDRILNNTDRPVQII
FAGKAHPHDTEGKELIRQIVQVSHQERFRHRIVFIEDYDMEVARHLVQGVDVWLNTPRRP
MEASGTSGMKVAFNAGLNLSILDGWWCEGYQGNNGWAIGKGEVYADLEYQNQVESGALYD
LLEKEVVPLYYQRGGDGIPRDWVSMMKASMQSLCPVFSTDRMVEEYAQLSYIPSYRQWTR
LEANDLGLAKELAAWKKRVFGGWNQVGIEATEAKLSDSVAVGSSLPVSVTVRLGGLKPDE
VAVEGYFGVLDNQGVIRGGEIVPLAVTETLESGRYRFAGELECRFCGRYGFMVRVMPRHT
ELGLIYEPGYLIWG
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atggatttttccaaactgctccataaattcaccgttgtcccttccctgtccgatgaactg
gccccgctgcaacggatcgcctacaacctctggtggtcctgggacccggatgcgattgcc
ctgttcaagcgcttggatattgatctctggaacgccacccgccacaatccggtggagatg
ctgggaatactgcagcagacaacccttgagtccctgaagcaggatgaaggctttatggcc
cacctgcagatggtggatgagaagctgaccgcctatatgtctgagaaatcctggtttcag
aaggagtacaacggcgatgctgaactgaagaccgcctacttttccatggagttcggcctg
catgaatcgctggcggtctactcaggtggtctggggattctggccggcgaccacctcaag
tcagcctctgatctgggcttgccgctggttggggtagggctgctgtatcgtcagggctat
ttccgtcagtatttgaacaacgagggctggcagcaggagatttatccggaaaatgatttt
tacaacctgccgctgattctggagcgggatcagctgggccgcccctttgaggtggagctg
gagtttgggccgcgtcacttcaaggcccatatctggcgggtgcaggtgggacgggtgccg
ctctatctgctggacaccaatctggaggaaaacaaccctgaagatcgcctgatcacgtca
caactgtacggcggcaatcaggaaatgcggatgctgcaggagatcctgctggggatcggc
ggggtgcgtgccctgcgtgccctgcggatcattcccaatgtctgccatatgaatgaaggc
catgccgccttcctggccctggagcggatcaggctggtgatggagaagcgcaagatcagc
tttaacgaggcccgtgaggtgaccagggccggtaacatctttaccacccacaccccggtt
gaggccggcattgatcacttccctactgaaatgctggataagtacttcactaaatatatc
aggtcattcaacctttcgcgggacgaatttctggggctgggacgtcagaacccggcagac
cagtacgagagcttctgcatggcggtgctggccctgaaactggccggtcatgccaatggt
gtcagtcagctgcatggcgaggtttcccgcagcatgtggaagaacctctggccggagctg
ccggaagagcagttgccgctcagctccattaccaacggggtccatacccgcacctggatg
tcaggccagatgggcagtctgctggtacgctacctgggtacccgctggctggatgacccg
accgatcacaatgtctggcgcaggatcggcaagataccggatgccgagatctggcgtacc
cgccagagcacccgcgaacggctggtggattttgcccgttgccgcctgaaggagcagttg
aaaaaggttggtgccactgccaaggagatcgccacagcggatgaggtgctggaccctgag
gtgctgaccatcggttttgcccgtcgttttgccacctacaagcggggtaccctgttgatg
cgggatctggaccgcttggaccggatcttgaacaacaccgatcgtccggtacagatcatt
tttgccggtaaggcccatccccacgacaccgaaggcaaggaactgatccgccagattgta
caggtttcccaccaggagcgtttccggcaccggatcgtctttattgaggattacgatatg
gaggtggcccgtcatctggtgcagggggtggatgtctggctgaacacaccccgtcgcccg
atggaggccagcggtaccagcggtatgaaggtggcctttaatgcgggcctgaacctttcc
atcctggatggctggtggtgtgagggctaccagggcaataacggctgggccatcggcaaa
ggtgaggtctacgctgatctggaatatcagaatcaggtggagagtggcgctttgtatgac
ctgctggaaaaggaagtggtgccgctctactatcagcgcggcggtgatggtattccccgt
gattgggtcagcatgatgaaggcctcgatgcagtcgctctgtccggtcttttcaaccgac
cggatggttgaggagtatgcccagctctcctatatcccttcctatcggcaatggacgcgg
cttgaggccaatgatctcgggcttgccaaggaactggcagcctggaagaaacgggtcttc
ggaggctggaatcaggtcgggattgaggccaccgaggcaaaattaagcgattcggtggcg
gtgggcagcagcctgccggtcagtgttaccgtcagacttggtggcctgaagccggatgaa
gtggcagtggaagggtacttcggcgtcctggacaatcagggggtcatccgtggtggcgag
attgttccactggcagtgacggaaacgttggaaagcggccgctaccgctttgccggagag
cttgagtgccgtttctgcggacgctatggttttatggtgcgggtgatgccgaggcatacg
gagttggggctgatatacgagccgggctatctgatctgggggtaa

DBGET integrated database retrieval system