KEGG   Gloeocapsa sp. PCC 7428: Glo7428_0458Help
Entry
Glo7428_0458      CDS       T02400                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
glp  Gloeocapsa sp. PCC 7428
Pathway
glp00010  Glycolysis / Gluconeogenesis
glp00053  Ascorbate and aldarate metabolism
glp00071  Fatty acid degradation
glp00280  Valine, leucine and isoleucine degradation
glp00310  Lysine degradation
glp00330  Arginine and proline metabolism
glp00340  Histidine metabolism
glp00380  Tryptophan metabolism
glp00410  beta-Alanine metabolism
glp00561  Glycerolipid metabolism
glp00620  Pyruvate metabolism
glp00625  Chloroalkane and chloroalkene degradation
glp01100  Metabolic pathways
glp01110  Biosynthesis of secondary metabolites
glp01120  Microbial metabolism in diverse environments
glp01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:glp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Glo7428_0458
   00053 Ascorbate and aldarate metabolism
    Glo7428_0458
   00620 Pyruvate metabolism
    Glo7428_0458
  Lipid metabolism
   00071 Fatty acid degradation
    Glo7428_0458
   00561 Glycerolipid metabolism
    Glo7428_0458
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Glo7428_0458
   00310 Lysine degradation
    Glo7428_0458
   00330 Arginine and proline metabolism
    Glo7428_0458
   00340 Histidine metabolism
    Glo7428_0458
   00380 Tryptophan metabolism
    Glo7428_0458
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Glo7428_0458
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Glo7428_0458
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Glo7428_0458
Enzymes [BR:glp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Glo7428_0458
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Ribosomal_L1
Motif
Other DBs
NCBI-ProteinID: AFZ29059
UniProt: K9XAF2
LinkDB All DBs
Position
complement(511738..513114)
Genome map
AA seq 458 aa AA seqDB search
MLAELSINDIIRKQRVYFQSGNTKNVEFRIAKLKTLKQAIQENAESIVNALKKDLYKPEL
ETYATEISITREIDYALKHIKSWVKPKKVRLPLEQLPGAGYIYPGPLGVVLIIGPWNYPF
QLVIAPLIGAIAAGNCVIVKPSEIAPNTSAVVSQIIQKYFDPSYIAVVEGGIDVSKQLLA
EKFDHIFFTGGTAVGKIVMEAAAKHLTPVTLELGGKSPCIVDTDINLEHTARRIAWGKFI
NAGQTCIAPDYLLVNRQIKPQLLDSLQKVIKEFYGEDPQQSSDYARIVNQKQFSRLAELL
HDGEIVTGGTTNSRDFYIAPTIIDRVSLEMPVMQEEIFGPILPIIEYGDLSEAIAIINEK
PKPLALYVFSRNKDIQQRVLKETSSGGVCINDTVMQVGVSSLPFGGVGDSGIGRYHGKAS
FDTFSHEKSVLKKSFWLDLKWRYAPYAGKLDLIKRLIG
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgcttgctgaactatctataaatgatattatccgtaaacaacgtgtttattttcagagt
ggaaatacaaaaaatgttgagtttcgaattgcaaaattaaaaactctaaagcaagcaatc
caagagaatgcagaaagcattgtcaatgcgctaaaaaaagatttatacaaaccagaatta
gaaacgtatgctacagaaattagcattacgcgagaaattgattatgctttgaaacatatc
aaatcatgggtaaagcctaaaaaagtacgtcttcccctcgaacaacttcctggggctgga
tacatctatccaggaccgctaggagttgtcttaattattggcccgtggaattatccgttt
cagttagttatagcgcctttaattggtgcgatcgccgcaggtaattgtgtcattgttaag
ccttctgaaattgcgccaaacacctcagcagttgtttcacaaatcatccagaaatatttc
gatccctcctacatcgccgttgtagaaggtggtattgacgttagcaaacaactcctagca
gaaaagttcgatcatatcttttttacaggtggtacagccgtcggtaaaattgtgatggaa
gccgcagcaaaacatcttacgccagtcactttagaattaggcggtaaaagtccttgcatt
gtagacaccgatattaatcttgaacatactgcgcgcagaatagcttggggtaaatttatc
aacgctggacaaacgtgcattgcacccgattatcttttagtcaatcgtcaaatcaaacca
caactgcttgatagcttacaaaaagttatcaaagaattttatggtgaagatccgcaacag
agttctgactatgccagaattgttaatcaaaaacaattttcacgtttagcagaattacta
cacgatggagaaatcgttaccggaggaactaccaattcgcgtgacttttatattgctcca
acgattattgatcgcgtctcactggaaatgccagtgatgcaagaagaaatttttggtcca
attttaccgattattgaatacggcgatttgagcgaagcgatcgcaatcatcaacgaaaaa
ccaaaacctttagcgttgtacgtgttttcgcgcaacaaagatattcaacagcgagtttta
aaagaaacttcttctggcggtgtttgtattaatgacactgtaatgcaagttggcgtttca
tctttaccgtttggtggtgtcggagatagcggaatcggaagataccacggcaaggcgagt
tttgatacgttctcgcatgaaaaaagcgtcttaaagaaatctttttggcttgatttaaaa
tggcgttacgcgccctatgcaggcaaactagacttaatcaaacggttaattggctag

DBGET integrated database retrieval system