KEGG   Gloeocapsa sp. PCC 7428: Glo7428_1042Help
Entry
Glo7428_1042      CDS       T02400                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
glp  Gloeocapsa sp. PCC 7428
Pathway
glp00630  Glyoxylate and dicarboxylate metabolism
glp00710  Carbon fixation in photosynthetic organisms
glp01100  Metabolic pathways
glp01120  Microbial metabolism in diverse environments
glp01200  Carbon metabolism
Module
glp_M00165  Reductive pentose phosphate cycle (Calvin cycle)
glp_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
glp_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:glp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Glo7428_1042
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Glo7428_1042
Enzymes [BR:glp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Glo7428_1042
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AFZ29616
UniProt: K9XC36
LinkDB All DBs
Position
1141494..1142924
Genome map
AA seq 476 aa AA seqDB search
MSYAQTKTQTKTGYQAGVKDYRLTYYTPDYTPKDTDVLAAFRVTPQPGVPPEEAGAAVAA
ESSTGTWTTVWTDLLTDLDRYKGRCYDIEPVPGEDNQYICYVAYPLDLFEEGSVTNMLTS
IVGNVFGFKALRALRLEDLRIPVAYLKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLG
LSAKNYGRAVYECLRGGLDFTKDDENINSQPFMRWRDRFLFVAEAIHKAQAETGEIKGHY
LNVTAPTCEEMMKRAEFAKELEMPIIMHDYLTGGFTANTTLARWCRDNGVLLHIHRAMHA
VIDRQKNHGMHFRVLAKCLRMSGGDHLHSGTVVGKLEGERGITMGFVDLMRENYVEQDRD
RGIFFTQDWASMPGVMPVASGGIHIWHMPALVEIFGDDSCLQFGGGTLGHPWGNAPGATA
NRVALEACIQARNEGRSLAREGNDVIREAAKWSPELAVACELWKEIKFEFEAMDTL
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgtcttacgctcaaacaaagactcagacaaagactgggtatcaggcaggggttaaagat
tatcgcttaacgtactacaccccagattacacacctaaagatacggatgttttagcggca
ttccgcgtcactcctcagcctggagttcctccagaggaagcaggagccgctgtagctgct
gagtcctctacaggtacatggacaacagtatggacggacttgttaaccgacctcgatcgc
tacaaaggtcgttgctacgatattgaacccgttccaggtgaagacaatcagtatatctgt
tacgttgcttacccattggatctgtttgaggaaggctccgttaccaatatgttgacctcg
attgtaggtaacgtatttgggtttaaagcactacgtgcattacgtttggaagatttgcgg
attcctgtcgcttacttaaagaccttccaaggacctccccacggtattcaagtagaacgc
gacaaactgaacaagtacggtcgtcctttgcttggttgtacaatcaaaccgaagcttggt
ctatcggctaaaaactacggtcgtgcagtttatgagtgcttgcgcggtggtctagacttc
accaaagacgacgaaaacatcaactcgcagccattcatgcgctggcgcgatcgcttcttg
ttcgtagcagaagcgattcataaagcccaagccgaaacaggtgaaattaaaggacactac
ctcaacgtcaccgctcccacttgcgaagaaatgatgaagcgggctgagttcgcaaaagaa
ctagaaatgccgatcatcatgcacgactatctaacaggtggtttcactgcaaatacaaca
ctggcgcgttggtgccgtgataatggcgttttgctacacattcaccgcgcgatgcacgcg
gtaattgaccgtcaaaagaatcacggtatgcacttccgcgtattagcaaaatgcttgcgg
atgtctggtggcgaccacttacactcaggaactgtcgttggtaagcttgagggcgaacgc
ggcatcacaatgggcttcgttgacctgatgcgcgagaactacgttgagcaagaccgcgat
cgcggaattttcttcactcaagactgggcttcgatgcctggtgttatgcctgtagcatct
ggtggtatccacatttggcatatgccagcgcttgtagaaatcttcggtgacgattcctgc
ttacaattcggtggcggaaccttaggacatccttggggtaacgcacctggtgcaacggct
aaccgtgttgcattagaagcttgtattcaagcgcgtaacgaaggtcgcagtttagcacgt
gaaggtaacgacgttattcgcgaagctgcgaagtggagtcctgaacttgcagttgcttgc
gaactgtggaaggaaatcaagttcgagttcgaggcaatggatacactctaa

DBGET integrated database retrieval system