KEGG   Gloeocapsa sp. PCC 7428: Glo7428_1764Help
Entry
Glo7428_1764      CDS       T02400                                 

Definition
(GenBank) amino acid adenylation domain protein
Organism
glp  Gloeocapsa sp. PCC 7428
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding Condensation PP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AFZ30319
UniProt: K9XDZ2
LinkDB All DBs
Position
1972782..1978091
Genome map
AA seq 1769 aa AA seqDB search
MPEHKNIQSCHAFNSMSKFSTIVELLRYRSNIQGEQLSYTFLADGETQSDRLTYQALDKC
SRAIASQLQSLGLSGERALLLYPPGLEYLAAFFGCLYAGVVAVPAYPPRNQRNTPRILAI
LDDAQAAIILTTAAILPQLQSLFADKINHIHWLATDHLAPGLEEAWQKPFINIDTLAFLQ
YTSGSTGTPKGVMLSHGNLLHNAEVTRQYMEHTSSSKFVTWLPIYHDMGLIGGVLQPLYS
GFPCIMLPPAAFLQRPYRWLQAISRYRGTTSGAPNFAYELCIEKITPEQRSTLDLSSWSV
AFNGAEPIRQETLEKFAATFAECGFRPEAFYPCYGMAEATLMVSGSVKSALVRSISLQKN
ALERNRLTHAVANTENSIQIVGCGRVVPQQEVVIANPETLTLCDSDQVGEIWVAGPSIGH
GYWNRLEETEQTFHAYLQDTRQGPFLRTGDLGFLHNGELFITGRAKDLIIIRGRNLYPQD
IELTAERSHKTLRVGSVAAFAVEVEKEERLVVVQELEFRAKPDIDEVTAAIRQAITEEHE
VEVYAVILIKAGTIPKTSSGKIQRRATKAGFLAGTLEVVGSSILEITQTTEREEVLTGRE
LLTLEPKQRQQLLNFYLQKLVAQVIRVKPSQINLEQPLGSLGLDSLKVFELKNRIEVDFG
VTLSVANFFDNTGISELTIQILDEVNNLTCEYLPISKVETTTNQHPLSFTQQQLWFINQL
QPGTATYNIPVAIHLTGLNVPALVRSLNEIIQRHDILRTSFEVVNGEPVQKVADTVTFTL
PEVNLCHLSDEQQQSEVQKLSRKEAQSSFDLGQAPLLRAKLLYLQAEQSILILTLHHLVG
DGWSIKDLVQELSAIYQAFVDGKPSLLPQLPVKYTDFVYWQRNYLQGEVIERCLAYWKQQ
LNGNLPVLQLPTDRPRPPIQTFKGAQQKFVLSTKLTEAIKQLSQREGVTLFMTLLAAFQT
LLYRYTDQEDILVGSPIANRNRVEIDQLIGCFVNNLVLRTNLEGNPTFTELLGRVRKVAI
DAYTHQDLPFEKLVEALQPNRDLSYNPLFQVMFVLQNSASNSIWKTEEIETGTAKFDILL
SMIDSEERLTGTLEYNTDLFNPDTIIRMVGHFQTMLGGIVSDSNQPIAELPILTFAERQT
LLEDWNNTQVNYPQEACIHNLFEAQVEKRPDAIALIFANVELTYRELNNRANQLAHYLQN
LGVKPEMLVGICMERAIEMVVGILAIMKAGGAYLPLDPTYPQERLAFMLEDAQLSLLLVQ
PHLVDELPPHEAKVVIIDADGAAFADYNQANLVSHTELENAAYVIYTSGSTGKPKGAINT
HKGLCNRLIWMQETYQLTSSDRVLQKTPFSFDVSVWEFFWTLFTGATLVIAKPGGHQDAS
YLVQLIGQQQITTLHFVPSMLQVFLEEPELEKCRSLKRVICSGEALPLELQKRFFERLDA
ELHNLYGPTEAAIDVTSWKCQKNSNAKIVPIGRPIANIQIYILDNYLQPVPIGIPGELHI
GGVGLARGYLNRQELTSEKFISSPFYPTKRLYKTGDLARYLPDGSIEYLGRIDRQIKLRG
CRIEIGEIETVIAQYSHVRETVVITNENRLIAYVVPHQKTPFSINELRHLLKVKLPEYMI
PAAFVVLESLPLTPNGKVDLRALPAPGNLRPELANNYQAPQSEVEKLIAKVWKQVLQLET
VGVDDNFFDLGGHSLLAVKVNNKLREIWNRNLSVVEIFQYPTIRSLAEHLSQEEVPVYLQ
AVHDRVKKQIEARSQQKELLRKRRKKLNN
NT seq 5310 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaacacaagaatattcaaagctgtcatgctttcaatagcatgagcaaattttcg
actattgttgaacttttgcgttatagaagcaatatacagggcgaacaactcagttacacg
ttcttagcagatggggaaacccaaagcgatcgcctcacgtatcaagctctagataaatgt
agtcgagcgatcgcctctcaactccaaagcttaggtttaagtggagagcgtgctttactg
ctttatccaccaggtttagagtatctagccgcctttttcgggtgtttgtatgctggggtt
gtagcagttccagcttatccaccacgcaaccaacggaatacccccagaatcttagcaatt
ttagacgatgcacaagcagcgataattctgactaccgcagccattttgccgcaattgcaa
tctttgtttgccgataaaatcaatcatattcactggctagctactgatcacctcgctcct
ggtctagaagaagcttggcaaaagccttttattaatatagacacattagcctttctgcaa
tatacatctggttctactggtacacccaaaggtgtcatgctcagtcatggcaacctactg
cacaatgctgaggtaacgcgccagtatatggaacatacctctagtagtaagtttgtaact
tggctgcctatttatcatgacatgggtttgattggtggcgtactgcaacctttatatagt
ggttttccttgtattatgctgccgccagcagcttttctccaacgtccttatcgttggtta
caagcaatttctcgttatagaggaaccaccagtggcgcgcctaactttgcttacgagctt
tgtattgaaaaaattacgcccgaacaacgctcaaccttagatttaagcagttggagtgta
gcttttaatggtgctgaacctattcgtcaagaaacgctagagaagtttgcagccaccttc
gctgaatgcggttttcgtccagaagctttttatccttgctatggcatggcagaagccacc
ttaatggtatctgggagcgtcaaatctgcgttagtaaggagcatatctttgcaaaaaaac
gctttagaacgcaaccgtctgactcatgcggttgctaacacagagaattcaatacaaata
gtcggatgtggtcgagttgtaccacaacaagaagttgtaattgccaatccagaaacctta
actttgtgtgattccgaccaagttggggaaatttgggtagctggacctagtattggtcat
ggttactggaaccgactagaagaaactgaacaaaccttccacgcttatctacaagacaca
agacaaggaccatttttacggactggagatttaggttttctgcacaatggcgaactcttt
ataacaggtagagctaaagatttaattatcatcagagggcgtaatctctacccacaagat
attgagttaaccgcagagcgcagccataaaacattacgagtaggaagtgttgcggctttt
gctgtagaggtagaaaaagaagaacgactagtagttgtacaagaattagagtttcgtgcc
aaacctgatatagatgaagtaacagctgctattcgccaagcaatcacagaagaacatgaa
gtagaagtttatgcagttattttaatcaaagctggcacgattcccaaaacttctagcggt
aaaatccaacgtcgagctaccaaagcaggatttttagcaggtacattagaggttgttggt
agtagtattctggaaattacccaaacaacagaacgagaagaagttctgacaggaagagaa
ttattaacactagaaccaaaacaacgacaacaattattaaacttctatttacaaaagcta
gtagcgcaggtaataagagtaaaaccttcgcaaataaatctagagcagcctttaggtagt
ttgggtttagactccctaaaagttttcgagttaaaaaaccggattgaggttgactttggt
gtaactctatctgtagctaacttctttgataatactggtattagtgagttaacaatccaa
atattagacgaagttaacaaccttacttgtgaatacttgcctatctctaaagtagagaca
actactaaccaacatccactgagctttactcaacagcagttgtggtttatcaatcaactg
caacctggaacagctacatataacattcccgtagctattcatctaacaggattgaatgtc
cctgcattggttcgtagcctcaacgaaattattcaaagacacgacatcttacgaaccagc
tttgaagtagtgaatggtgaacccgtccaaaaagttgcagatacagtcacattcacttta
ccagaagttaatttgtgccatttatccgatgaacagcagcagtctgaagtgcaaaagtta
tcccgaaaagaggctcagtcatcttttgatttaggacaagcacctttgttacgggcaaaa
ctgctgtacttgcaagcagaacagtcaatattaattttgacgctgcatcatttagttggt
gatggttggtcaatcaaggatttagttcaagaattatctgcgatttatcaagcttttgtt
gatggtaaaccctctttgctacctcagcttcctgtaaagtacacagattttgtatattgg
caacgaaactacttacaaggcgaagttatagaaagatgtttagcttattggaagcagcag
ttaaacggaaatctacctgtattgcaactacctactgatcgtcccagaccgccaatacaa
acttttaaaggagcgcagcagaagtttgtattgtctacaaagttaactgaagcaatcaaa
cagttaagccaacgggaaggtgtaaccttatttatgaccttgttagcggcgtttcaaaca
ttgctataccgctatacagatcaggaagatattcttgtcggttcaccgattgctaatcgc
aaccgtgttgaaatagatcagttgattgggtgctttgtcaataatttagtattgcgtact
aatctagaaggaaatcccacatttacagaattgttggggcgagtacgaaaggtagcaatt
gatgcttatactcatcaagatttaccttttgagaagttagtagaagcattacaaccaaat
cgggatttaagctataatccactgtttcaggtgatgtttgtgcttcagaattctgcatca
aatagcatttggaaaactgaggaaattgaaacagggacagctaagtttgatatcctgtta
tcaatgattgatagtgaagaaagattaacagggacactagaatataacaccgatttattt
aatccagatacgataattagaatggttgggcatttccaaaccatgctagggggtatagtt
agtgattctaaccagcctattgccgagttaccaatattgacttttgctgaacgtcagacg
ctactagaagactggaacaacactcaggttaattatcctcaagaagcttgcattcataac
ttgtttgaggcgcaggtagaaaaaagaccagacgcgatcgctctcatttttgctaatgta
gaacttacctatcgagagttaaacaatcgagccaatcaactagctcactacctacaaaat
ttaggtgtgaaaccagaaatgctagttggaatctgcatggaacgcgctatcgaaatggta
gtgggaattttagcaattatgaaagctggtggtgcgtatctaccgctagatcctacctat
cctcaagagcgtttggcattcatgctagaagatgctcaactatcattgttgctagtgcaa
ccgcatctagtcgatgaactaccaccacacgaagccaaagtagtaattatagacgctgat
ggtgcagccttcgctgactacaaccaagctaatttagttagtcatacagaactagaaaac
gcagcctatgtcatttatacttctggttccacaggaaaaccaaaaggcgcgattaacacg
cacaaaggtctttgcaaccgcttaatatggatgcaggaaacttatcaattaacatcaagc
gatcgcgttttacaaaaaacacccttcagttttgatgtctccgtttgggaattcttctgg
actctctttactggtgcaactttagtcatagcgaagccaggtggacatcaagatgcaagc
tatttagtccaactcatcggtcaacagcaaattacgacattgcactttgttccttcaatg
ctgcaagtgtttttagaggaaccagaactagaaaagtgccgtagtcttaaacgtgtaatt
tgtagtggtgaagcactacccttagaactacaaaaacgcttctttgagcgtttggatgca
gaattacacaatctctacggtcctacagaagcagcaattgatgtgacttcttggaaatgt
caaaaaaatagcaacgcgaaaatagttcctatcggtcgtcctatcgctaacatccagata
tatatattagacaattatttgcaacctgttccaattggtattcctggtgagttacatatt
ggtggtgtaggtttagcaagaggctatctaaatcgacaagaattgacgagcgaaaagttt
atttctagcccgttttatcctaccaaacgtctttataaaacaggagatttagctcgttac
cttccagatggcagtattgaatacttgggaagaattgaccgtcaaattaaactgcgcggt
tgccgtattgaaataggagaaattgaaacagttatagcccaatattctcatgtacgagaa
acagtagtcattactaatgaaaatcgtcttattgcttatgtggttcctcatcaaaaaaca
cccttttctatcaatgaattaaggcatttacttaaggtaaaactgcctgaatatatgatt
cctgctgcctttgtagttttagaatccttaccgcttacacctaatggcaaagtagacctt
cgtgctttacctgcgcctggtaacttgcgtccagaattagccaataactatcaagctcct
caatctgaagtagaaaaattaatagctaaggtttggaaacaggtactacagctagaaaca
gtaggtgttgatgataatttctttgatcttggcggacattctttgctggcagtaaaggta
aacaataaactcagagaaatttggaaccgcaatttatcagttgtagaaatttttcagtat
ccaactattagatcgctagcagaacatttaagccaagaagaagtacctgtttatttacaa
gctgtacatgaccgagttaaaaagcaaatagaagcccgaagtcaacaaaaagaactatta
aggaaacgacgaaagaaattgaataattag

DBGET integrated database retrieval system