KEGG   Gloeocapsa sp. PCC 7428: Glo7428_1962Help
Entry
Glo7428_1962      CDS       T02400                                 

Definition
(GenBank) nitrate ABC transporter, inner membrane subunit
  KO
K15577  nitrate/nitrite transport system permease protein
Organism
glp  Gloeocapsa sp. PCC 7428
Pathway
glp00910  Nitrogen metabolism
glp02010  ABC transporters
Module
glp_M00438  Nitrate/nitrite transport system
glp_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:glp00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    Glo7428_1962
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Glo7428_1962
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:glp02000]
    Glo7428_1962
Transporters [BR:glp02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    Glo7428_1962
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 RSB_motif
Motif
Other DBs
NCBI-ProteinID: AFZ30509
UniProt: K9XEI2
LinkDB All DBs
Position
2209692..2210525
Genome map
AA seq 277 aa AA seqDB search
MTTLGSRAPRSRNQQKTMSFVTKYIVPPLIAIAVFLIVWQLLFSSPDANLPGPITVLQET
WDPLIINPFFDYGGTNKGLGLQILASLGRVAIGFSLAAIAGIALGILIGISPFIYRALDP
LFQVLRTVPPLAWLPLSLAAFQQANPSAIFVIFITAIWPIIINTTVGVQQIPQDYRNVAK
VLRLSGPKFFWKILLPSAVPYIFTGLRIGIGLSWLAIVAAEMLTGGVGIGFFIWDAYNSS
RLSEIILALIYVGIVGLILDRIVAFVASKVVPEEQKA
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgacaacacttggtagccgcgcccccagaagcagaaatcagcaaaagacgatgtccttc
gtaacaaaatacatcgtgccgccactgattgcgatcgctgtttttttaattgtttggcag
ctacttttttcaagcccagatgcaaatttaccaggtccaattacggtacttcaagaaaca
tgggaccctttgattatcaacccgttttttgattatggtggaacaaataaaggattaggt
ttgcaaatcctcgccagtttaggacgagttgcgatcggcttttccttagcggcgatcgcc
ggaattgcgctgggaattctcatcggtattagtccgtttatctatcgcgcgctcgatcct
ttatttcaggtgttgcggactgtaccacctttggcatggctaccgctgtcactcgcagca
tttcaacaagctaacccttcggcaattttcgtcatctttatcaccgcaatttggccgatc
atcattaacaccaccgtgggcgtacaacaaattccccaagattatcgcaacgttgcgaaa
gtgctgcgcctgtcgggaccaaagtttttctggaaaatattacttccgtctgcggttccc
tatatctttacggggttaagaatcgggattggtttatcttggctagcgatcgtcgccgca
gaaatgctaacaggtggtgtaggaatcggcttctttatctgggatgcttacaacagttcg
cgcttgagtgagattatcctcgcgctaatttatgtcggtatcgttggtctaatcctcgat
cgcatcgtggcttttgtcgcctccaaagttgtcccagaagagcaaaaggcttaa

DBGET integrated database retrieval system