KEGG   Gloeocapsa sp. PCC 7428: Glo7428_2389Help
Entry
Glo7428_2389      CDS       T02400                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
glp  Gloeocapsa sp. PCC 7428
Pathway
glp00500  Starch and sucrose metabolism
glp01100  Metabolic pathways
glp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:glp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Glo7428_2389
Enzymes [BR:glp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     Glo7428_2389
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3417 Phosphorylase Capsule_synth
Motif
Other DBs
NCBI-ProteinID: AFZ30900
UniProt: K9XE41
LinkDB All DBs
Position
complement(2690950..2693505)
Genome map
AA seq 851 aa AA seqDB search
MQPIYTFNVSPALPPHLEKLRQLAYNIHWDWNTEAKDLFRRLDLDLWESSHHNPVLMLGT
ISQTRLQEVVEDEGFLAQMDRAARQLEEYLQDGTWYERNRSQESECYAYFSAEFGLVDCL
PIYSGGLGVLAGDHLKSASDLGLPLVGVGLLYQQGYFAQYLNPDGWQQERYPINDFYNMP
LHLERHPDGSELRIAVPYPGRTVYARVWRVQVGRVPLYLLDTNIEPNNPYDHDITDQLYG
GDIDMRIHQEIMLGIGGVLMLKALGYKVTAYHMNEGHSAFLTLERIRGLMQEGLDYATAR
QVVISSNIFTTHTPVPAGIDLFPPDKILYYLGHYADEFGLSKDQFLGLGRENTGDLTAPF
SMAVFALKMATFANGVAQLHGVVSREMFQGLWRSLPEDEVPITAITNGVHARSCVAKSTQ
ELYDRYLGPTWSSAPTDHQLWERVDAIPDEELWRNHERCKVEMIVAVREHLVKHLRDRGA
SPAEIASSQEVLDPSTLTIGFARRFATYKRATLWMRDIDRIKRILMANKDRKVQFVIAGK
AHPKDIPGKELIRDINHFIQEHGVEKQVVFVPNYDIHIARLLVAGCDVWLNTPRRPREAS
GTSGMKAAMNGLLNLSVLDGWWDEADYVRTGWAIGHGESYDDPHYQDEVEANAFYELLEK
EVVPLFYNRDADGLPRQWLAKMKAAIRYNCPFFNTARMVRDYARKAYFPASDRYHTLTAN
HYSPARELAQWKVNLLDRWFNIKIVNIDIAASSDVQVNQNISVKAQIDLANLSPEDVQVE
LYQGAVDASGEIVNGIAHEMNFQGRDQQGYSIYTGTITYTTSGLQGLSLRVLPKHALLSS
PYEPRVIMWAN
NT seq 2556 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccaatttacacattcaacgtctcgccagctttgccgccccatctagaaaaactg
cggcagcttgcctacaatattcactgggactggaacactgaagctaaagacttattccgc
cgcttggatctagacctttgggaatcgagtcatcacaatcctgttttgatgctaggaaca
attagtcaaacacgactgcaagaagttgtggaagacgaaggctttctcgcgcaaatggat
cgcgcggcgcgccagttagaagaatatttgcaagacggaacgtggtacgaaagaaatcga
agccaggaatcagagtgttatgcgtatttttccgctgaatttggcttagttgattgctta
ccgatctattctggaggtttgggcgttttagcaggcgatcatctcaaatcagctagtgac
ttaggattaccactcgtaggagttgggctactttaccagcaaggctattttgcgcaatat
cttaaccctgatggctggcaacaagaacgctacccaattaatgacttctataatatgccg
ctgcatttagagcgtcatcctgatggttcagagttacgcattgcggttccttatcctgga
cgtactgtttacgcgagagtatggcgcgtgcaagtggggagagtaccgctttacttactc
gataccaatatcgaacccaacaacccttacgatcacgatatcaccgatcagttatacggt
ggtgacatcgatatgcgcatccaccaagaaattatgctgggaattggtggggtgttgatg
ctcaaggcattaggatacaaagtgacagcgtaccatatgaacgaaggtcactcggctttt
ctcacgttagagcgcatccgtggcttaatgcaagaagggctagattatgccacagcaaga
caagtcgtcatttcgagtaatatctttactactcacactcctgtacccgcaggaattgac
ttgtttccacccgataaaattttgtattacttggggcattatgctgatgagtttggatta
tccaaggatcaatttttggggttgggaagagaaaatacgggcgatctcactgcgccattt
agtatggcagttttcgcgctgaaaatggcaacgtttgctaatggtgtagcgcaattgcat
ggtgtcgtgtcgcgcgagatgtttcaaggcttgtggcgcagtttaccggaagatgaagtt
ccaattaccgcgattacgaatggcgttcatgcgcgtagttgtgttgctaaatcaacgcaa
gaattatacgatcgctaccttggtcctacttggtcatctgcaccaaccgatcatcaactt
tgggaacgtgttgatgctatccccgatgaagaattatggcgcaatcacgaacgctgtaag
gtagaaatgattgtcgcggtgcgcgaacacttggtcaagcatttacgcgatcgcggtgct
tcgccagcagaaattgcctcttcccaagaagttctcgatccctcaacgctgacgattggt
tttgcgcgtcgctttgcaacttataagcgcgcaacgctgtggatgcgagacattgacagg
atcaagcgcattcttatggcaaataaagatcgtaaagtgcaatttgtgattgcgggtaaa
gcccatccgaaagatattcctggtaaagaactgatccgcgatattaatcactttattcag
gaacatggtgtagaaaagcaagttgtctttgtgcctaactatgacattcacatcgcccgt
ttactcgttgcaggttgcgatgtatggttaaatacaccgcgccgccctagagaggcttcg
ggtacaagtggaatgaaagcagcgatgaatggattgctgaacctcagtgtccttgatggt
tggtgggatgaagctgattatgtgcgcacaggttgggcaattggacacggtgaatcttac
gacgatcctcattatcaagatgaagtcgaagccaatgctttttatgagttacttgaaaaa
gaagttgttcccttgttctataaccgcgatgctgacgggctaccgcgtcaatggcttgcc
aagatgaaagccgcaattcgctacaattgtccattctttaataccgcgcggatggtgcgc
gattatgctaggaaagcctatttccccgcaagcgatcgctaccatactttgacagcgaat
cactactctcctgcacgcgagttagcgcagtggaaagtgaatcttctcgaccgctggttt
aatatcaaaattgtcaatattgatattgctgcgagttctgatgtgcaagtcaatcaaaat
atctcggtaaaagcccaaattgacttggctaatctttctccagaagatgtgcaggtagaa
ctttatcaaggtgcggttgatgcgagtggcgaaattgtgaacggaattgcgcatgaaatg
aatttccaaggtcgcgatcaacaaggctatagcatttatactggcacgattacttataca
acttccggtttacaaggcttgtcgttgcgcgttttaccaaagcacgccttgctttcgagt
ccgtatgaacctagggtgattatgtgggcaaattag

DBGET integrated database retrieval system