KEGG   Gloeocapsa sp. PCC 7428: Glo7428_3260Help
Entry
Glo7428_3260      CDS       T02400                                 

Definition
(GenBank) catalytic domain-containing protein of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
glp  Gloeocapsa sp. PCC 7428
Pathway
glp00010  Glycolysis / Gluconeogenesis
glp00020  Citrate cycle (TCA cycle)
glp00620  Pyruvate metabolism
glp01100  Metabolic pathways
glp01110  Biosynthesis of secondary metabolites
glp01120  Microbial metabolism in diverse environments
glp01130  Biosynthesis of antibiotics
glp01200  Carbon metabolism
Module
glp_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:glp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Glo7428_3260
   00020 Citrate cycle (TCA cycle)
    Glo7428_3260
   00620 Pyruvate metabolism
    Glo7428_3260
Enzymes [BR:glp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Glo7428_3260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding AATase GCV_H MadL PASTA
Motif
Other DBs
NCBI-ProteinID: AFZ31746
UniProt: K9XI57
LinkDB All DBs
Position
3614293..3615618
Genome map
AA seq 441 aa AA seqDB search
MIHEIFMPALSSTMTEGKIVSWVKSPGDKVEKGETVVVVESDKADMDVESFYEGYVATIL
VEAGDSAPVGSAIALLAETEAEIETAKQQAQSGGATQSEADTTTSPGQIADVSTTVAATA
ADTAEASSNGNGAAHRAGRVMVSPRARKLAKELKVDLSNLQGSGPHGRIVAQDIEAAAGK
TQPTPAAQPQIKAPVAPPPTPTVKSAPAPAPAPVATAAPGQVVPLNTLQNAVVRNMVASL
QVPTFHVGYTITTNELDKLYKQIKSKGVTMTALLAKAVAVTLQKHPLVNASYSEQGIQYR
SAINIAVAVAMDDGGLITPVLQNADQIDIYSLSRNWKSLVDRARLKQLQPEEYNSGTFTL
SNLGMFGVDRFDAILPPGQGAILAVGAARSQVVAIDGMFGVRQQMQVNITCDHRIIYGAH
AAAFLQDLAKLIETNPQSLTM
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgattcacgaaatatttatgcctgcgcttagctcgactatgactgaagggaaaattgtc
tcttgggtcaaatcgcctggtgacaaagtggaaaaaggcgaaacagtggtagttgtcgaa
tccgacaaagctgatatggatgtcgaatccttttatgaaggttacgtggcgacaatttta
gtagaagcaggtgatagcgctcccgttggttcggcgatcgcgcttttggctgaaaccgaa
gctgaaattgaaactgccaagcaacaagctcaatctggcggcgctacgcagtctgaagcc
gatacgacaacctcaccagggcaaattgcagatgtttcaacgacggttgcagcaactgcg
gctgacactgctgaagcctcctcaaatggaaatggtgcagcacatcgtgccggacgcgtg
atggtttcgccacgggcacggaaactcgccaaagaactcaaagttgacttgagtaatctg
caaggtagtggtcctcacggtcgaattgtggcacaagatatcgaagcagcagcaggtaaa
acccaaccgacaccagccgcacaaccgcaaatcaaggctcctgtcgcaccaccacccaca
ccaacggttaaaagcgctcctgcacccgcaccagcccccgtcgctactgctgcaccaggt
caagtcgtacctttgaatacgctgcaaaatgccgtagtgcggaacatggtagcaagttta
caagtgcctaccttccacgtcggctacacgattacgaccaatgaattagataagctgtac
aagcagattaagtctaagggcgtgacgatgactgcgctgttggcgaaagctgttgctgtg
acgttgcagaaacatccgctggtaaacgccagctattcggaacaaggtattcaatatcgt
agtgcgattaacattgctgttgctgtggcgatggatgatggtgggttaatcaccccagta
ttgcaaaatgccgaccaaattgatatttattcactatcacgtaattggaaatcgctagtt
gaccgcgctcgtctgaagcaactacaacctgaagaatacaacagcggtactttcacgttg
tccaatttggggatgtttggggtcgatcggtttgatgcgattttaccaccaggtcaagga
gcgattcttgcggtaggtgctgcgcgatcgcaagttgtcgcgatcgatggaatgttcggt
gtgcggcagcaaatgcaagtcaatattacgtgcgaccaccgtatcatatatggcgcgcac
gcggctgcctttttacaagatttagcgaagttgattgagacaaatccccaatcgctcaca
atgtaa

DBGET integrated database retrieval system