KEGG   Gloeocapsa sp. PCC 7428: Glo7428_3886Help
Entry
Glo7428_3886      CDS       T02400                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
glp  Gloeocapsa sp. PCC 7428
Pathway
glp00473  D-Alanine metabolism
glp00550  Peptidoglycan biosynthesis
glp01100  Metabolic pathways
glp01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:glp00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Glo7428_3886
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Glo7428_3886
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Glo7428_3886
Enzymes [BR:glp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Glo7428_3886
Peptidoglycan biosynthesis and degradation proteins [BR:glp01011]
 Precursor biosynthesis
  Amino acid ligase
   Glo7428_3886
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_4 CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: AFZ32342
UniProt: K9XKX5
LinkDB All DBs
Position
complement(4321463..4322575)
Genome map
AA seq 370 aa AA seqDB search
MNKLRVGLLFGGRSGEHEVSISSARAIAQALLSGSNQQKYELLPFYIQKDGRWLPGDIAQ
QVLASGTPLQLDESNTQLPSDNSTSLPIPTSPYLPVSSASSQSQVADVDVWFPILHGPNG
EDGTVQGLLQLMQVPYVGSGVLGSAMGMDKIAMKMAFAQAGLPQVKYMAVNRAQVWSNPC
VFPKLCDQIEATLGYPCFVKPANLGSSVGITKVRSRSELETALDNAASYDRRLIVEAGVV
ARELECAVLGNDNPKASVVGEITFESDFYDYETKYTAGRAALSIPASVPESVAAAIQEMS
LQAFAAVDAAGLARVDFFYVEATGEILINEINTLPGFTATSMYPQMWEKSGVPFTELVDR
LIQLALERHR
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaataaattgcgagtagggttgctgtttggcggtcgttcgggcgaacatgaagtttca
attagttccgcacgcgcgatcgcacaagcactcctatcaggttcaaatcaacaaaaatac
gaacttctgccgttttatattcaaaaggatgggcgctggcttcctggagacattgcgcag
caagttctcgcgtctggtactcccctccaacttgatgaatcaaatacgcagctaccgagt
gacaactcaacatcgctcccaattccaacatctccctatctacccgtttcctcagcttcg
tcgcagtcgcaagttgccgatgtagatgtctggtttccgatccttcacggtccgaatggt
gaagacggtacagtccaaggtttgttgcaattaatgcaggtgccctacgtaggttctggg
gtattaggttccgcgatgggcatggataaaatcgcgatgaaaatggcatttgcccaagct
ggattgccgcaagtcaagtacatggcagttaaccgcgcgcaagtgtggtcaaatccttgc
gtgtttcctaaattatgcgaccaaatcgaagcaacgcttggttatccatgctttgtgaaa
cccgcgaatttagggtcttcggttggtattaccaaagtgcgatcgcgcagtgaattagaa
acagccctagacaatgccgctagctacgatcggcggttaattgtcgaagcaggcgttgtt
gctcgcgaactagagtgtgcggttttgggcaacgataaccccaaagcttcggtcgtcgga
gaaattacctttgagagtgatttctacgactatgaaacaaaatatactgcgggtcgagca
gcgttgtcaattcctgcatctgtaccagaatcagtcgctgcggcaattcaagagatgtcg
ttgcaagcttttgcggctgttgacgcggcgggtttagcacgagtcgatttcttctacgtt
gaagccacaggagaaattctgattaacgaaatcaatacattaccaggctttacagcaaca
agtatgtatccgcaaatgtgggaaaaaagtggcgttcccttcacagaattagtcgatcgc
ctcatccaattggcattagaaagacatcgttag

DBGET integrated database retrieval system