KEGG   Glarea lozoyensis: GLAREA_00723Help
Entry
GLAREA_00723      CDS       T04883                                 

Definition
(RefSeq) DNA ligase/mRNA capping enzyme, catalytic
  KO
K10777  DNA ligase 4 [EC:6.5.1.1]
Organism
glz  Glarea lozoyensis
Pathway
glz03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:glz00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    GLAREA_00723
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:glz03400]
    GLAREA_00723
Enzymes [BR:glz01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     GLAREA_00723
DNA repair and recombination proteins [BR:glz03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     GLAREA_00723
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase BRCT_2 BRCT mRNA_cap_enzyme DNA_ligase_IV
Motif
Other DBs
NCBI-GeneID: 19459781
NCBI-ProteinID: XP_008083672
UniProt: S3DT02
LinkDB All DBs
Position
Unknown
AA seq 971 aa AA seqDB search
MPASQRLPDDGANEEDQSQYHRNAASNEDLDEKYPNRPHNHSRTLFFGDLLTDLFNPLNE
NKKRPSGPKIARAKVGPHGPGVKSAHEVRRSIIERFISKWRTVVGNDFYPALRLILPEKD
RDRLMYGLKEKAIGKIVVRMLSIAKGSDDASDVLNWKLPAKNASTQMAGDFAGRCYELLK
GRAMINGKGDMRIAEVNELLDDLSKEGKEDAQLKIFDKFYHRMSADELMWLIRIILRQMK
IGASEKTILELWHPNAEALFNVCSSLRRVCWELTDPESILDSEDTGVELMACFQPQLAQF
QQHNFQKMVDKMGMPAENPAFWIEEKLDGERMQMHMVVDDSHPGGKRFGFWSRKGKDYTY
LYGDGYEDDNSALTRHIKNAFDPRLRNIILDGEMITWDPDIDKIVAFGTLKTAALSEQKN
PFQTSGQRPLFRVFDCLYLNDRDITRYTLRDRRKALEKVLTDVYRRIELHHYEEVQEAQA
IEPALRQVVAEASEGLVLKNPESPYRLSMRDNVWMKVKPEYMMDFGESLDCIVIGGYYGS
GRANPMKCFSFCKVGGGFRAEDYAAIRHLTGGKWVDWNRDNPPNEFIELAGGDRQLERPD
MWIKPSDSVVLEVKAASVGPSESFKTNYTLRFPRFKKLREDKDWQSALSLSEFALLKTKV
EAESSQRGFVVQAKRKMTKRLKKEVVIAGTDSKIKTPYAGPQTKVFEGLDFHVMTDMLQP
FKKSKAELEQMIKANGGSIYASPTAKEHIICIAEKRPVKVASIIKRGETNIVRPAWLFDA
IQQSEIDGPHRSRFLIPFEPTHMFHLIESSREDIEGNVDIYGDSYMRDITPLELGKLCEE
MLHPKTQDFDAGMFRLQLEERGRGIGELPGNIFGRHMIRFVSSARTDAEKDIDLFLLRTQ
FSFAGGKIAESDGADGITHFVVVDEGDEDVVSGLRRKIAERRGPVPRIVRLKWLRDSWAE
KTVLDEERYAI
NT seq 2916 nt NT seq  +upstreamnt  +downstreamnt
atgccggccagccaaagacttccggacgacggggctaacgaggaagaccaaagccaatac
catcgaaatgctgccagtaacgaggacttagatgaaaagtatcctaatcgaccacacaat
cactcacgaactctattctttggtgatcttttgaccgatttatttaatccactgaatgag
aataagaaaagacctagtggccccaaaatcgcacgtgcaaaggttggccctcatggaccg
ggtgttaaatcagcgcatgaggttcgtcggagtatcattgagagattcatatcaaaatgg
cggacagttgttggcaatgacttctaccctgcgctgagattgatccttcctgaaaaggat
cgtgacagactcatgtatgggttgaaagaaaaagcaatcgggaaaattgttgtccggatg
ctcagtattgccaagggatccgacgatgcctcagatgttctgaattggaagttgccagcc
aagaatgcgtcgactcagatggcgggtgattttgctggaagatgctacgagctactcaag
ggacgagctatgatcaacggtaaaggtgacatgcgtattgcagaagtcaatgaattatta
gatgatctttccaaggagggaaaagaagacgcgcaactaaagatcttcgataagttctac
cataggatgagtgcagacgaattgatgtggttaattcgaatcatacttcgtcaaatgaaa
atcggagcctctgaaaagaccattctggagctctggcatcccaacgcagaagccttgttc
aatgtgtgctcgagtcttcgtcgtgtttgctgggagctcaccgacccagaaagcatctta
gactctgaggacacaggtgtcgagctcatggcttgttttcaacctcaacttgcgcaattt
cagcaacacaactttcagaaaatggtggataagatgggaatgcctgccgaaaatccagcc
ttctggattgaagagaagcttgatggggaaagaatgcagatgcacatggttgtggatgat
agtcatccaggtggaaaacgatttggattttggtcgcggaaaggtaaagattatacttac
ctgtatggtgacggctacgaggacgacaactcggccttgactcgacacatcaagaacgct
tttgatccgagactaagaaatatcattctcgacggtgagatgattacatgggaccccgac
atagacaaaatagtagctttcggtactttaaagacagccgctctatcagagcagaagaac
cctttccagacgtctggtcaacgaccgctttttagagttttcgattgtttatatctcaat
gatcgagatattacaaggtatacgctgagggatagaagaaaagctctagaaaaggtactt
actgatgtgtatcgacgaattgagctgcaccactacgaggaggtacaagaagcccaggct
atcgagccagctttacgacaagtcgtggctgaggcgtcagaaggtctcgttctcaagaat
ccagagtcaccctatcgcttaagtatgcgtgataatgtgtggatgaaagtcaagccggaa
tacatgatggatttcggagaatctctggactgtattgtcatcggtggttactatggttct
ggtcgggccaatccgatgaagtgcttctccttctgcaaagttggtggtgggtttagagca
gaagattatgcagcaatccggcacctcacaggaggcaagtgggttgattggaatcgtgac
aatccaccgaacgagttcatcgaacttgcgggtggtgacagacagctcgaaagacctgac
atgtggattaaaccatccgattctgttgttctcgaggttaaagctgcatcagtcggtcca
tctgaatctttcaagaccaactatacgttgagatttcctagattcaagaaattgcgagaa
gacaaagactggcagtctgcattatctctctctgagtttgcacttctcaaaaccaaagtc
gaggcagaatccagtcagagaggtttcgtcgttcaagccaaacgaaaaatgacgaaaaga
ctcaagaaagaggtcgtgattgcaggcacagatagcaagatcaaaacgccatacgcagga
ccacaaacaaaagtgtttgaagggttggatttccacgtcatgacagacatgctccaacca
ttcaagaaatccaaagcagaactggagcaaatgatcaaagcaaacggcggatccatctac
gccagtcccacagcaaaagagcacatcatctgtatcgccgagaagcggcccgtcaaagta
gccagtatcatcaagagaggcgaaaccaacatcgtccggccagcctggctattcgatgct
atccagcaatccgagatcgacgggccgcatcgctcaagattcctgatcccgttcgaacct
acccatatgttccacttgatcgagagttctagggaggatatcgaggggaacgtggatatc
tatggggatagttatatgcgtgatatcacgcctctagaactggggaagttgtgcgaggag
atgttacatcccaagactcaagactttgacgccgggatgtttcggctgcaactcgaagag
cgtgggcgagggattggagagttacctgggaacatctttggacggcacatgatcagattc
gtgtcgtcagcacgtacagatgcggagaaggatatcgatctctttctacttcgaacgcag
ttttccttcgcgggtggcaagattgcggaaagtgatggtgcggatgggattacgcatttt
gtggttgttgatgagggggatgaagatgtggtgagtgggttgcggaggaagattgcggaa
cgaaggggtccggtgcctaggattgtgaggttgaaatggctgcgggattcttgggctgag
aagactgttttggatgaggagagatatgctatttag

DBGET integrated database retrieval system