KEGG   Glarea lozoyensis: GLAREA_01884Help
Entry
GLAREA_01884      CDS       T04883                                 

Definition
(RefSeq) Alkaline phosphatase-like protein
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
glz  Glarea lozoyensis
Pathway
glz00730  Thiamine metabolism
glz00790  Folate biosynthesis
glz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:glz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    GLAREA_01884
   00790 Folate biosynthesis
    GLAREA_01884
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:glz04147]
    GLAREA_01884
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:glz00537]
    GLAREA_01884
Enzymes [BR:glz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     GLAREA_01884
Exosome [BR:glz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GLAREA_01884
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:glz00537]
 Enzymes
  GLAREA_01884
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-GeneID: 19460942
NCBI-ProteinID: XP_008087291
UniProt: S3CHM3
LinkDB All DBs
Position
Unknown
AA seq 567 aa AA seqDB search
MSPNPPLFASDRRSSSSHSEERAAAEDTALLGNQRKDNSSPQQKSRFWREIGLFAWALIA
TAAVIVLAVYSQHQGSSGDGKKTSPKGKKNLIFMVSDGMGPASLSMTRSFRQFQSGLPID
DVLVLDQHFIGSSRTRSSNSLVTDSAAGATAFSCGMKSYNGAISKLPDHSSCGTVLEAAK
RAGYMTGLVVTTSITDATPACFASHVDTRAEEDLIAQQEVGEHPLGRMVDLIFGGGRCHF
LPNTTSESCRGDGRDITKLAREKYGWNYIDNRKDFDGIRSGSAVKLPLLGLFARYNFPYE
LDRRNMNDIYPSLDEMARTALNALEAATQDSDKGFFLMIEGSRIDHAGHGNDPAAQVNEV
LAYDKAFASVLEFLDRSKTESVLVSTSDHETGGLSIARQLDPTYPEYLWYPEVLNNVSST
AEHSARRLASYVAAGSKNVESFIRKELVKKGLGIKDATDAEIKTIIAAPNSYSFASMISR
RAQIGWSTHGHSAVDVNIYGTAGSERLNGNHENTEVGKFLRDYLDLNVDAITKELNEKEK
AKSASTEETIRPLVEMHSMPDGIDDEL
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgtctccaaatccacctctctttgcgtctgatcgacgaagctcctcgagtcactctgaa
gagcgtgctgccgcagaagatacagcgcttctgggaaaccaacggaaagacaattccagc
cctcagcagaagtcaagattctggcgtgaaattggcttgtttgcgtgggcattaatcgct
acggctgcagttattgtcctcgccgtctactcgcaacaccagggctctagtggagatgga
aagaaaacatcgcccaagggcaagaagaaccttatcttcatggttagtgatggaatgggt
ccagcaagcctttccatgactcgcagctttcgccaatttcagagcggtctacccattgac
gatgtactcgtcctcgatcaacacttcatcggctcatcgcgaacaagatccagtaacagc
ctggtcactgattctgctgctggggctacagcattctcctgcggaatgaaaagctacaat
ggagctatctcaaaactaccagatcatagcagttgcggtactgtgcttgaagccgcgaag
agggcaggctatatgacgggattggttgtgacaacgtcgattacagatgccacgccggct
tgctttgcatcacacgtggatacgcgcgccgaggaggacttaattgctcaacaggaagtc
ggagaacatcctcttggtcgaatggtggaccttatctttggcggaggtcgatgtcatttc
ttgccaaacacaacttctgagagctgcagaggggatggcagagatattacgaaactcgca
cgggaaaagtacgggtggaactatattgataacaggaaagattttgatgggatcaggtcg
ggaagcgctgtcaaacttccactattggggctttttgcacgctacaacttcccatacgag
cttgatcgccgaaatatgaatgatatttatccttctttagacgagatggcacgaactgct
ttaaatgcattagaagctgctacgcaggacagcgataagggtttctttctcatgattgaa
ggaagccggatagaccatgctggccatggaaacgatcctgctgctcaagtaaatgaggtt
ttagcttacgacaaagcattcgctagtgtgctcgaatttctagatcggtcaaagaccgag
agtgtacttgtttcaactagtgatcacgagactggtgggctctctattgctagacaattg
gatccaacgtaccccgaatacttgtggtatccagaggtgttgaacaatgtctccagtact
gccgagcattctgcgcgtcgactagcttcatatgtggcagctggaagcaagaatgttgag
agtttcattcgaaaagaactcgtcaagaagggcttaggtatcaaagatgctacagacgcc
gagataaaaaccatcatcgccgctcccaactcatattctttcgctagtatgattagtcgt
cgtgctcagataggctggagcactcacgggcattctgcagtcgacgtaaatatctatgga
acagcaggttcggagaggttgaatggaaaccacgaaaatacagaagtcggcaaattcctc
cgcgattacctagacctaaacgtagacgccatcaccaaagagctaaacgagaaagagaag
gccaaatccgcatcgacagaagaaactatacggccattagtagagatgcatagcatgccc
gatggtatagacgatgaactctag

DBGET integrated database retrieval system