KEGG   Glarea lozoyensis: GLAREA_02282Help
Entry
GLAREA_02282      CDS       T04883                                 

Definition
(RefSeq) Actin-like ATPase
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
glz  Glarea lozoyensis
Pathway
glz00010  Glycolysis / Gluconeogenesis
glz00051  Fructose and mannose metabolism
glz00052  Galactose metabolism
glz00500  Starch and sucrose metabolism
glz00520  Amino sugar and nucleotide sugar metabolism
glz01100  Metabolic pathways
glz01110  Biosynthesis of secondary metabolites
glz01130  Biosynthesis of antibiotics
glz01200  Carbon metabolism
Module
glz_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
glz_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:glz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GLAREA_02282
   00051 Fructose and mannose metabolism
    GLAREA_02282
   00052 Galactose metabolism
    GLAREA_02282
   00500 Starch and sucrose metabolism
    GLAREA_02282
   00520 Amino sugar and nucleotide sugar metabolism
    GLAREA_02282
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    GLAREA_02282
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:glz04131]
    GLAREA_02282
Enzymes [BR:glz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     GLAREA_02282
Membrane trafficking [BR:glz04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    GLAREA_02282
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 FGGY_N
Motif
Other DBs
NCBI-GeneID: 19461340
NCBI-ProteinID: XP_008087689
UniProt: S3CKU3
LinkDB All DBs
Position
Unknown
AA seq 476 aa AA seqDB search
MVDVPKDLIDEIKKLEEHFTVDTAKLKEITEHFINELTKGLSVEGGSIPMNPTWCMAMPT
GEEQGTFLALDMGGTNLRVCEIILTDQKSEFDIIQSKYRMPEELKTGDADELWEYVADCL
QQFVEAHHPGENLDKMHLGFTFSYPATQDYIDHGVLQRWTKGFDISGVEGENVVPMFEAA
IARRGVPIKLTALINDTTGTLIASAYTDTKMKIGCIFGTGCNAAYFENTGSIPKLAHMKL
PPDTPMAINCEWGAFDNEHKVLPRTPYDIIIDKDSPRPGQQAFEKMIAGLYLGELFRLVL
VNLHDNEGVHIFEGQNIDKLRKAYTLDSSFLSLVEEDPFENLSETADLFQNKLSISPNRS
ELELIRRLAELIGTRAARLSACGVAAIAKKKGYESCHVGADGSVFNKYPHFKQRGAQALR
EILDWPEKKNQKEEDPIEILAAEDGSGVGAALIAALTLQRVKDGNMAGILHPENFK
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggtagatgtgccaaaagatttgattgacgaaattaagaagctcgaggagcactttact
gtcgataccgcaaagctgaaggagatcaccgaacacttcatcaatgagcttactaaaggt
ctctctgttgagggtggaagcattcccatgaaccctacctggtgtatggctatgccaacc
ggtgaagaacaaggaactttcttggctctagacatgggtggaaccaaccttcgtgtttgt
gaaattatcttgaccgaccaaaagtcagagtttgacatcatccaatctaaataccgaatg
ccagaagaactcaagactggtgatgctgatgagctctgggagtatgttgctgattgtttg
caacaattcgtcgaagcacatcaccccggggagaatctcgacaagatgcatcttggtttc
actttctcctacccagccacccaagattacatcgatcacggggttcttcaacgctggact
aaaggattcgatatttctggtgttgagggagagaacgttgttcctatgtttgaagctgcc
attgcgagaagaggggtaccaatcaaacttactgctctgatcaacgacaccactggaact
ctgatcgcttctgcgtacaccgacacaaagatgaagatcgggtgtatcttcgggactggt
tgcaatgccgcttactttgagaacactgggtcgattccaaagttggcacacatgaagctg
ccaccagatactccaatggccatcaactgcgaatggggtgcttttgacaatgagcacaaa
gtgttgccaagaactccctacgatatcattattgacaaagactctcctcgtcctggtcaa
caagcattcgagaagatgattgctggtctgtatctcggtgaacttttccgtctcgtcttg
gtcaatcttcacgacaacgagggtgtccacatctttgaggggcaaaatatcgacaagcta
cgaaaggcatacacacttgattcttctttcctttccttggtcgaagaggatccctttgaa
aatctgtcagagacagctgatctcttccaaaacaaactcagcatctcaccaaaccgttct
gagcttgaacttatccggcgtcttgcagaactaatcggtactcgggctgctcgtctctcc
gcctgtggtgtcgcagctatcgccaagaagaagggttacgaatcttgccatgttggtgct
gacggatccgtcttcaacaagtaccctcacttcaagcagcgaggtgctcaggctcttcgt
gaaatcctcgactggccagagaagaagaaccagaaagaggaagatcctatcgagatcttg
gctgccgaagatggttctggtgtaggtgctgcacttattgctgctttgacccttcaacgt
gttaaggatggcaacatggctggtattctccacccagagaacttcaaatga

DBGET integrated database retrieval system