KEGG   Glarea lozoyensis: GLAREA_03384Help
Entry
GLAREA_03384      CDS       T04883                                 

Definition
(RefSeq) Six-hairpin glycosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
glz  Glarea lozoyensis
Pathway
glz00500  Starch and sucrose metabolism
glz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:glz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GLAREA_03384
Enzymes [BR:glz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     GLAREA_03384
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15 CBM_20
Motif
Other DBs
NCBI-GeneID: 19462439
NCBI-ProteinID: XP_008081828
UniProt: S3CVH8
LinkDB All DBs
Position
Unknown
AA seq 683 aa AA seqDB search
MALQSLLQPFSPSNITAVASSNSLISSLNATTNWKERMWYTATSLLLAGSIALQSVFAHP
GSYTLNQREAAVLKRSVDSFITTESPIALSRILCNIGSDGACVPGAKTGIVIAGPGKANP
DYFYTWTRDAALTFKALVDTFITNYSASLQSEITAYITAQAALQTVGNPSGGLSSGGLGE
PKFNADGSAFTGSWGRPQRDGPALRATALITYAKWLVSNGYSSTATSLVWPVIQNDLSYV
AQYWNNTGFDLWEEVSGSSFFTIAAQHRALVEGSALAKQLGKSCTYCDSQAPQVLCFLQS
FWGPSQGYILANINVGGRSAKDANTLLGSIHIFDPAAGCDASTFQPCSDRALANHKVVID
SFRSVYSLNSGIAEGVAVSVGRYPEDSYYGGNPWYLNTLAAAEQLYDALYTWNRQKSITI
TAVSLPFFRDFSSSAAVGTYASSSSTYTTLYNAIKVYADGYVNVVATYAQKNGSLSEQFS
KSNGQPLSAYDLTWSYAAFLTAAARRAGKVPYSWGEPAANNVPCACVPSSAIGTYSAAPT
SAFPASQTPASSPASLPTPTSTSATICPSPTTIPVTFKVLATTTYGQTIKLVGSVAALGN
WAPANAITLSAAQYTASNPLWFGTVGLPAGTRVEYKYINVAADGSVTWEGGANRVYTVPA
SGTGGTDKGEIACSGFLKGFAKP
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atggctcttcaatcactcctgcaacctttctctccttccaacatcactgcggttgcttct
tctaactcccttatatcgtctcttaacgcgacaacaaattggaaagaaagaatgtggtac
actgccacttcactgctattagcaggcagcatcgctctccagagcgtgttcgctcatccc
ggctcttatactctcaatcagcgagaagccgctgtcttgaaacgctcggtggactcattc
atcacaactgaaagtccaattgcgttgtccagaatattatgcaatatcggttcagatgga
gcttgtgttccaggagcaaagactgggattgtcatcgctgggcctggcaaagccaatcct
gactacttctatacctggacacgagatgcagctttgactttcaaggctctggttgacact
ttcattactaactactcggcttcattgcaatctgaaataacagcatatatcaccgctcaa
gctgctctccaaactgttggcaatccttctggtggtctatcaagcggtggtttgggggaa
ccaaagttcaatgctgatgggtctgcttttactggctcatggggtagaccacagcgagat
gggccagctctccgtgctactgctctcatcacttacgctaagtggttggtgagcaatggt
tatagctccactgctacctcactagtttggcctgtcatacagaatgacttgagttacgtc
gcacagtactggaacaatacaggcttcgacttgtgggaagaagtttccggttctagcttt
tttacgattgctgctcaacaccgtgcattagtagaaggaagtgctttagccaagcagctc
ggcaaatcttgcacgtactgcgactcacaggcaccacaagttctctgcttcttgcaaagc
ttttgggggccatcccagggatatattcttgctaacatcaacgtcggcggtcgatctgct
aaagatgcaaacactttgctaggatcaattcatatatttgatcctgccgctggctgtgat
gcaagtacttttcaaccgtgctcagatcgtgccttggcgaatcacaaggtagtcatagac
tcattcagatcagtatactcactcaattccggcatcgctgaaggtgttgctgtgtctgtt
gggcgataccctgaggattcttactatggcggcaatccatggtacctgaacacccttgcc
gctgctgagcagctgtacgatgctctgtacacctggaatcgtcaaaagtccatcactatt
accgcagtatcacttccattcttccgcgatttcagttcttcagctgcagtaggaacatat
gcctcatcatcatcaacatacaccactctctacaacgcgatcaaagtatacgcagacggg
tacgtcaatgtcgtagctacatatgctcaaaagaatggctcattgtccgagcaattttcc
aaatccaatggacaaccactttcagcatatgatctgacatggtcttatgccgcctttctg
acagctgctgcgcgaagagctggaaaggtgccatactcttggggagaaccagctgctaat
aatgtaccatgtgcatgtgtcccatcttcggcaattggtacatactcagcagctccgaca
tctgcattcccagctagtcaaactccggcatcctcccccgcatccctcccaacacccaca
tctacctccgcaaccatttgtccctcaccaaccaccatcccagtaactttcaaagtcctc
gccaccaccacctacgggcagaccatcaaactagtcggctccgtcgccgccctcggtaac
tgggcgcctgcaaacgccatcacgctttccgcagcacagtatacagcgtcgaacccgctt
tggttcggtacagtgggtttgccggctggtacgagggttgagtataagtatatcaatgtc
gctgccgacggatcggttacttgggagggaggcgcgaatagggtctatactgttccggcg
agtgggacgggtgggactgacaaaggagagattgcttgtagtggctttcttaagggcttc
gctaaaccttga

DBGET integrated database retrieval system