KEGG   Glarea lozoyensis: GLAREA_03724Help
Entry
GLAREA_03724      CDS       T04883                                 

Definition
(RefSeq) L
  KO
K17550  protein phosphatase 1 regulatory subunit 7
Organism
glz  Glarea lozoyensis
Brite
KEGG Orthology (KO) [BR:glz00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:glz01009]
    GLAREA_03724
Protein phosphatases and associated proteins [BR:glz01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     GLAREA_03724
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_4 LRR_8 LRR_9 LRR_6
Motif
Other DBs
NCBI-GeneID: 19462779
NCBI-ProteinID: XP_008082168
UniProt: S3CWL7
LinkDB All DBs
Position
Unknown
AA seq 378 aa AA seqDB search
MTTSDNENTPPRISINLDDIKGHEGDSSPGGGTPKSSTGWDGKLRLEKKLELVNPEALSD
PEYSDEEQVLSGETIEADEDLLDDYPLDTEEIDCVHARVSSVPLLRLERFTAVARLCLRQ
NTITEIEGFSCLAATLKELDLYDNLIAHIRGLDDLTNLTSLDLSFNKIKHIKKVNHLTNL
TDIYFVQNKIGKIENLEGLTKLRNLELAANRIREIENLETLTGLEELWLGKNKITQISNI
DSLQNLKILSIQSNRIRGITGLDNLPHLEELYISHNALTSLSGLEKVMGLRVLDVSNNQI
TSIKGLKHLEDLEEVWASYNQIGDIAEIEEELKERKKLNTVYFEGNPLQLRNPTLYRNKV
RLTLPQVMQIDATFVRVS
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgactacttcagacaacgaaaatacccctccgcgaatttccataaacctcgacgatatc
aagggtcatgagggtgattcttctcccggtggtggcactccaaagagcagtacagggtgg
gatggaaagctgcgattagaaaagaagctggaacttgtgaatccagaggcattgtcggat
ccagaatattcagacgaagagcaggttctttctggagagactattgaggcggacgaagat
ctcctcgacgactaccctctcgacacggaagaaatagactgcgtccatgcccgcgtatct
tcagtacccctcctccgtctcgaacgattcacagccgtcgcacgattatgcctccgccag
aatacaatcactgagatcgagggattttcatgtctggccgcaacgttgaaagaactggac
ctatacgacaatttgattgcacatatccgcgggttagatgatttgacgaatcttaccagt
ctggatctctcgttcaataagatcaagcacatcaagaaagtcaaccatcttacaaatcta
acggatatatattttgtgcagaataaaattgggaagatcgagaatctggaaggtcttaca
aaattgcgaaatctcgagcttgctgccaaccgaattagagagattgagaatctagaaact
ttgactggcctggaagaattgtggttagggaagaacaagattacccagatttccaacatc
gacagtctccagaacctcaaaatcttgagtattcagtctaaccgaatccgcggaatcacc
ggtctggacaaccttccacatcttgaagaattatatatctctcataacgccctcacaagc
ctgtctgggcttgagaaggttatgggtttacgggtgctagatgtcagcaacaatcaaatt
acaagtattaaaggactcaagcacctcgaagatttagaggaggtctgggcaagctataac
caaattggtgatattgcagaaattgaagaagagttgaaagagcgcaagaagttgaacact
gtctattttgagggaaatcccttacaactcagaaatccaaccttgtaccggaacaaggtc
cgcttgactttaccacaagtcatgcagattgatgccacatttgtgagagtttcatga

DBGET integrated database retrieval system