KEGG   Glarea lozoyensis: GLAREA_05210Help
Entry
GLAREA_05210      CDS       T04883                                 

Definition
(RefSeq) PLP-dependent transferase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
glz  Glarea lozoyensis
Pathway
glz00250  Alanine, aspartate and glutamate metabolism
glz00410  beta-Alanine metabolism
glz00430  Taurine and hypotaurine metabolism
glz00650  Butanoate metabolism
glz01100  Metabolic pathways
glz01110  Biosynthesis of secondary metabolites
Module
glz_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:glz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    GLAREA_05210
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    GLAREA_05210
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    GLAREA_05210
   00430 Taurine and hypotaurine metabolism
    GLAREA_05210
Enzymes [BR:glz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     GLAREA_05210
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 19464264
NCBI-ProteinID: XP_008076690
UniProt: S3DBS2
LinkDB All DBs
Position
Unknown
AA seq 513 aa AA seqDB search
MATQSSELPIRNGPAKTDPPLNRADEVDDLLTSVKSLIIPFIKAADEDASSKASGHGLAI
PGAGPRTALVEHHPPQKLRSLMDFQIPGDGRGKEGLLEVVEKVLKFSVNTWDQGFLDKLY
ASTNAVGVISELLLAVLNTNVHVFQVSPALSVIEKTTSQALAQKFGFTSPHAGGVSTQGG
SASNTTSLIIARNTLYPETKTSGNGSHQFVLFTSAHGHYSLEKAAQMCGLGTENVISVPV
DKQGRMIPEEFEKLVLKSKDEGKTPFYLNATAGTTVLGSFDPFTELSAICKKHNLWLHID
GSWGGPVIFSSAQKHKLKGAELADSLAVNPHKMLGTPVTCSFLLGPDIRIFHKANTLPAG
YLFHSNDGADSEVWDLADLTLQCGRRGDSLKLALSWIYYGSSGYETQIDHAFSVTAHFTS
LLKNSSNFELVSEDPPPCLQVCFYYKKNGSLGSDEENTKTTSEIVRKLIPRGFMVDYAPG
EKGSMFRVVVNVQTRRETIEGLVKGIEEVGGEL
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atggcaactcagagctctgaacttcccatccggaatggccccgccaagaccgatcctcct
cttaatagagcggatgaggttgatgatctacttacatcagtcaaaagtctcataattcca
ttcatcaaggcagctgatgaggatgcgtccagcaaggcatccggccatggacttgctatc
ccaggagctggtcctcggactgcgctagtggaacatcatccaccacagaaactacgttct
ctaatggacttccaaattccaggagatggcagaggaaaagaaggattgttggaagttgtg
gagaaagtgttgaagtttagtgtgaatacttgggatcaggggtttttagataagttatat
gctagtactaatgctgtgggagtcatctctgaactccttctcgcggttttgaacacaaat
gtacacgtcttccaggtctcgccagctttatcagtcattgagaagactacatcacaagca
ctcgctcagaaatttggcttcacgtcacctcatgctggtggagtctctacacagggcggt
tcagcctctaataccacatctctcatcattgcccgtaacactttatatcctgaaacgaaa
acatctgggaacggaagtcatcaattcgtactgtttacttcagcgcatggacattattcc
ttggaaaaagcagctcaaatgtgtggactcggaacggagaacgtgatatccgtcccagtt
gacaaacaaggtcgcatgatccccgaggaattcgagaagctagtcctcaaatcaaaagat
gaaggaaagacacccttctacctgaacgcaacagctggaaccacagtcctaggctccttc
gacccatttaccgaactgtcagccatttgcaaaaagcacaacctctggctccacatcgac
ggctcctggggcggtccagtcatcttctcgtcagcccaaaaacacaagttgaaaggcgca
gaactagccgattctctggccgtaaatccacacaaaatgctcggcacacccgtaacctgt
tccttcctcctcggtcccgacatccgcatcttccacaaagcaaacaccctcccagcaggc
tacctcttccacagcaacgacggcgccgactccgaagtctgggatcttgctgacctaacc
cttcaatgcggacgtcgcggcgattctctcaagcttgcgttgagctggatatactacggt
agttccggctatgaaacgcaaattgaccatgcgttttccgtaaccgctcatttcacttcc
ctgctcaaaaacagctcgaatttcgaacttgttagtgaggatccaccaccctgtctccaa
gtctgcttttattataagaagaacgggagtttgggaagtgatgaggaaaatacgaagacg
acaagtgagattgtgaggaaacttattccaaggggctttatggttgattatgcgcccggg
gagaagggaagtatgtttagggttgttgtaaatgtgcagactagacgggagactattgag
gggctggtaaagggcattgaggaggttgggggggagttgtaa

DBGET integrated database retrieval system