KEGG   Glarea lozoyensis: GLAREA_05732Help
Entry
GLAREA_05732      CDS       T04883                                 

Definition
(RefSeq) FAD/NAD(P)-binding protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
glz  Glarea lozoyensis
Pathway
glz00020  Citrate cycle (TCA cycle)
glz00190  Oxidative phosphorylation
glz01100  Metabolic pathways
glz01110  Biosynthesis of secondary metabolites
glz01130  Biosynthesis of antibiotics
glz01200  Carbon metabolism
Module
glz_M00009  Citrate cycle (TCA cycle, Krebs cycle)
glz_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
glz_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:glz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GLAREA_05732
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    GLAREA_05732
Enzymes [BR:glz01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     GLAREA_05732
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4 FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 19464786
NCBI-ProteinID: XP_008077212
UniProt: S3DGY5
LinkDB All DBs
Position
Unknown
AA seq 647 aa AA seqDB search
MSSIAMRRFAAGPSVSRALKNQTRTFSSTRPAARIITHAPLRAKEASPFLSNKYPVVDHE
YDAIVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAALGNMHEDDWRW
HMYDTVKGSDWLGDQDAIHYMTREAPQSVIELENYGCPFSRTEDGKIYQRAFGGQSQKFG
KGGQAYRCCAAADRTGHALLHTLYGQSLRHNTNYFIEYFALDLIMEDGECKGVIAYNQED
GTLHRFRAHNTVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLPNQDLEFVQFHPTGIY
GAGCLITEGARGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPDK
DHLYLQLSHLPPDVLHERLPGISETASIFSGVDVRKQPIPVLPTVHYNMGGIPTKYTGEV
LTVDGEGKDKVVPGLFACGEAACVSVHGANRLGANSLLDLIVFGRAVSHTVRDNFEPGMP
HKEISADAGAESISVLDQIRTADGPKSTHEIRLAMQKVMQTDVSVFRTQESLDEGVSKIN
AVDQTFKDVGTKDRSMIWNSDLVETLELRNLLTCAVQTAESAAARTESRGAHAREDFPER
DDKEWMKHTLSYQKKPQGKTNLSYRSVVGTTLDENECKAVPPFKRVY
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcaatcgctatgcggaggttcgcagctggtccttcggtttcgagggcactgaag
aaccagaccagaacattttcctcaacgcgtcctgctgcgcggataataacacatgcgcct
ttgcgagcgaaggaagcaagtccattcctcagcaataaatatccagtggtggaccacgag
tacgatgccatcgtcgtcggtgctggtggagcaggtctgcgagcagccttcggtcttgcc
gaggcaggtttcaacacggcgtgtatatccaagctcttcccaactcgaagtcacacagta
gcagcacaaggaggaatcaatgcggcgctgggtaacatgcacgaggacgactggaggtgg
cacatgtacgacaccgtcaaaggttcagattggttaggagatcaggatgctattcactat
atgacaagggaggcgccacagtccgtcatcgaattggaaaattatggttgccccttctca
agaacggaagatggaaagatctaccaacgtgcgttcggaggacaatcgcagaaatttggc
aaaggtggacaggcctaccgatgctgcgctgctgcggatcgaactggacacgctctcctt
cacaccctatacggtcaatctctcagacataacaccaactacttcatcgaatacttcgct
ctcgatctgattatggaggatggcgagtgcaagggtgttattgcttacaaccaagaagat
ggaaccctccaccgattccgagcacacaacaccgttctagcaactggaggttacggacgt
gcctatttcagttgcacatctgcacacacgtgcactggtgacggaatggctatggttgcc
cgtgccggtcttcctaaccaggatctcgagttcgttcaattccacccaactggtatttat
ggtgctggatgcttgattaccgaaggagctcgtggagagggtggatatctcctcaactct
gagggtgagcggtttatggaacgttatgcaccaactgccaaggatttggccagtcgagat
gtcgtttcccgatcaatgactatggagatccgtgaaggccgtggtgttggccctgataag
gaccatctatacctgcaactcagtcacttgccaccagatgttctccacgaacgtcttcca
ggtatctctgagactgcctctatcttctctggtgtcgatgttcgaaagcagccaattcca
gttcttccaaccgttcactacaacatgggtggtatcccaaccaaatatactggtgaggtt
ctcactgtggatggtgaaggcaaggacaaggtcgtcccaggtctttttgcatgtggtgag
gctgcttgtgtctcggttcacggtgccaaccgtcttggagccaactcgctgctcgatttg
atcgtcttcggtcgtgctgtatcgcacactgttcgggataacttcgagcctggtatgcca
cacaaggagatcagcgctgatgctggtgccgagtctatcagtgtccttgaccagatccgt
actgccgacggaccaaagtctacacacgagattcgtcttgctatgcaaaaggttatgcag
acagatgtcagtgttttcagaacccaagaaagtttggatgagggtgtcagcaagatcaat
gctgttgaccagaccttcaaggatgttggcaccaaggacagaagcatgatctggaattct
gacttggtcgagacactcgaattaagaaacttgttgacctgcgctgttcaaaccgcagag
tcagcagcagctagaaccgaatcccgtggagctcacgcacgtgaggatttcccagaaaga
gacgacaaggaatggatgaagcacacattatcttaccagaagaagccccaaggaaagacc
aacctctcataccgaagtgtggtcggtaccaccctagacgagaatgagtgcaaggcggtc
ccaccattcaagcgtgtatactag

DBGET integrated database retrieval system