KEGG   Glarea lozoyensis: GLAREA_06101Help
Entry
GLAREA_06101      CDS       T04883                                 

Definition
(RefSeq) Thiolase-like protein
  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Organism
glz  Glarea lozoyensis
Pathway
glz00061  Fatty acid biosynthesis
glz00780  Biotin metabolism
glz01100  Metabolic pathways
glz01212  Fatty acid metabolism
Module
glz_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:glz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    GLAREA_06101
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    GLAREA_06101
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:glz01004]
    GLAREA_06101
Enzymes [BR:glz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.179  beta-ketoacyl-[acyl-carrier-protein] synthase II
     GLAREA_06101
Lipid biosynthesis proteins [BR:glz01004]
 Fatty acid synthase
  Component type
   GLAREA_06101
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N KAsynt_C_assoc
Motif
Other DBs
NCBI-GeneID: 19465155
NCBI-ProteinID: XP_008079706
UniProt: S3D7I0
LinkDB All DBs
Position
Unknown
AA seq 430 aa AA seqDB search
MRRVVVTGLGAITPLGVGVRQTWTRLIAGHSGIVSVADLEPQERWQPLPSTIAGTIPGNG
NKDEYRWQVLDWLSKGEERRMAKFSQYAIAATEMALQDADWRPATEAQKESTGVCLGSGI
GNLEELYDTSIAYEKAGYKKVSPLFVPQLLINLGAGHISIKYGLQGPNHAVTTACTTGAH
AIGDASRFIALGDADVMVAGGSESCIHPLALAGFARSRSLATSFNHDPKSASRPFDKARE
GFVIAEGAGVIILEELEHAKARGAQIYAEVRGYGCSGDAHHITAPRADGHGAFLAMKRAL
RNANIPPKNVDYINAHATSTPLGDAAENSAIQHLMLGEDGKESAYQIAVSSTKGAIGHLL
GAAGAVEAIFSILATKEDVLPPTLNLESLDTGFRCNYIPGSAQHKIVNVSMSNSFGFGGT
NASLVFSKYP
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgcgacgcgtggtagtaacaggtctgggtgcgatcactccattaggagtaggtgtgcgg
cagacttggacccgtttgatagctggccatagtggtattgtcagcgttgctgatctcgaa
cctcaagagcgatggcagccacttcccagcacaattgcaggcaccattccgggcaatggc
aacaaggacgaatatagatggcaagtgctggactggttgtcaaaaggcgaagagcgacgg
atggcaaaattcagccagtatgcgatcgctgcgacagagatggctcttcaagacgccgac
tggagaccggccacagaagcacagaaggaatcgaccggagtttgtctcggcagcggcatt
gggaacttggaagaactgtacgataccagtattgcctacgaaaaagcaggctacaaaaaa
gtatcgccattatttgtgccccaattacttataaacctgggggcgggacacatatccatc
aagtatggtcttcaggggcccaatcatgccgttacaacagcgtgtactactggcgctcat
gccattggcgatgcgtcgcgctttatcgccttgggagacgccgatgtgatggttgctgga
gggtcagagtcgtgtatccacccacttgcacttgctggctttgcaagatcgaggtcactt
gctacatcctttaatcatgatcctaagtcggcttcccgtcctttcgacaaagcaagagag
ggctttgtcattgctgaaggtgccggagttatcatattagaggagttagaacacgccaaa
gctcgtggtgcccagatatatgcagaagttcgcggctatggctgcagcggggatgcacat
catataactgctcctcgagcggacggacatggcgctttcctggctatgaaacgggctttg
cggaatgcaaatattcctccgaaaaatgtcgactacattaatgcacatgcaacaagtacg
ccacttggagatgcggccgaaaatagtgcaatccaacacctgatgcttggggaggacggc
aaggagagcgcgtatcagatcgcggtcagtagtaccaagggtgcaatcggtcatcttctg
ggggctgctggtgcagttgaagctatattttcaattcttgccacgaaagaggatgtcctg
ccacccaccctcaatctagagagtcttgatactggcttcaggtgcaattacattcctggt
tctgcacagcataaaattgtcaatgtttctatgtcaaatagctttggattcggaggcacc
aacgcctcgctcgtcttctcaaaatacccatga

DBGET integrated database retrieval system