KEGG   Glarea lozoyensis: GLAREA_06108Help
Entry
GLAREA_06108      CDS       T04883                                 

Definition
(RefSeq) GroES-like protein
Organism
glz  Glarea lozoyensis
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 ADH_N_assoc 2-Hacid_dh_C Sacchrp_dh_NADP Shikimate_DH NAD_binding_7
Motif
Other DBs
NCBI-GeneID: 19465162
NCBI-ProteinID: XP_008079713
UniProt: S3DM01
LinkDB All DBs
Position
Unknown
AA seq 543 aa AA seqDB search
MRAARYHGIGDIRVEEIEEPTCGEGQVKVKPAFVGICGTDLHEYLGGPNFAPETPHPVTG
ETIPITFGHEFSGTVLEVGKGVTNFKPGQHVSIQPTIYDGTCNACHLGLQNVCYHGGFVG
LSGWGGGLSDACVIPADYVLPLPDNVPLDIAALVEPLAVGWHAVSRSPLKKGSTILILGG
GPIGIAVINALKAQGCGKIIVSEISSSRQKFCSHFGADVILNPTKDDVIKRVKEETGGDG
VDIVFDCAGVAVGLTAACKCIKVRGTVVNVAIWEKAVPFQPNDLVFKEGSYVACLGHAKQ
DFKDVIEALGNGSMKPGDMITAKIALEHVVDQGFKQLIDNKEAHKVNKTFVLLLDYEYDT
NPEHQIWSIITSKDASLAKATPPTLPPLKELNSDFEGWSLDQLYDFMSENEEVLGKAGFD
VSSWAMLDDEALENDTVLLVEHNFELDEDEEDEEEREARLMGNVKYKAVRAPAEEAHTVF
VNLQIANMGFEDFVNEEAGHVNGVWQYISCGGESNEGVYSMANDATKEQDEAIKKGQEEG
WLE
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgcgagcagctagataccacggtattggagatatccgagtagaggagattgaggagcct
acatgcggtgagggacaggtcaaggttaagcctgcattcgtaggaatctgcggaactgat
cttcacgaataccttggtggcccgaatttcgcccccgaaacccctcatcctgtaactggc
gagacaattcccatcacttttggacatgagttctcggggactgtcttggaagtcggcaag
ggcgtcacaaacttcaagcctggtcaacatgtatcaatacaacctacaatctacgatgga
acctgtaacgcgtgccatttaggtctgcagaatgtctgttatcatggaggattcgttggt
ctgtctggttggggcggtgggttgagcgacgcatgtgtgatcccggccgattatgtgctt
cctcttccagacaacgtcccacttgatatcgcagctctggtagaaccgttggcggttgga
tggcacgctgtttcgagaagtccactgaaaaagggttcgactatcttgattttgggaggg
ggaccaattgggatcgctgtcattaatgccctaaaagctcaaggttgcggcaagatcatc
gtctcggaaatctcatcctcgcgtcagaaattttgctcgcactttggtgcagacgtcata
ttgaatccgaccaaagacgatgtaattaagcgagtcaaagaggaaacaggcggagatggc
gtcgacattgtgttcgactgtgccggcgtagctgtgggcttgacggccgcttgcaaatgc
atcaaagtcagaggcacagtggtcaatgtggctatttgggaaaaggccgtaccgttccaa
ccaaacgatttagtattcaaggagggcagctatgtggcttgtctaggacacgcgaaacag
gattttaaagacgttattgaagccctaggtaatgggtcgatgaaaccgggcgacatgatc
acagcaaaaatcgcactcgagcatgtggtagaccaggggttcaagcagctgattgacaat
aaggaagctcataaagtaaacaagacatttgtcctgctccttgactatgaatatgacaca
aacccggaacatcaaatctggagcatcataacctcaaaagacgcctctctcgctaaggcc
acccctccaacgctcccaccactcaaggagctcaacagcgactttgaaggttggagtctc
gatcagctttatgacttcatgtctgaaaatgaggaagttctcggaaaggcgggatttgat
gtcagctcatgggctatgcttgacgacgaagccttggaaaatgacaccgtcttgctagta
gagcataatttcgagttggatgaagatgaagaggatgaggaggagagggaggcgagatta
atgggtaatgtgaagtataaagctgtcagagcaccagcagaggaggcacatactgttttc
gtgaatctccaaatcgcaaacatgggcttcgaggactttgtgaatgaggaagccggtcat
gtaaatggcgtgtggcagtatatctcatgtggcggggaatcgaacgagggggtatacagc
atggcaaatgacgctactaaagagcaggacgaagctattaagaagggacaagaggaagga
tggttggagtag

DBGET integrated database retrieval system