KEGG   Glarea lozoyensis: GLAREA_07300Help
Entry
GLAREA_07300      CDS       T04883                                 

Definition
(RefSeq) (Trans)glycosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
glz  Glarea lozoyensis
Pathway
glz00052  Galactose metabolism
glz00500  Starch and sucrose metabolism
glz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:glz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    GLAREA_07300
   00500 Starch and sucrose metabolism
    GLAREA_07300
Enzymes [BR:glz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     GLAREA_07300
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 DUF1522
Motif
Other DBs
NCBI-GeneID: 19466353
NCBI-ProteinID: XP_008080179
UniProt: S3D0W0
LinkDB All DBs
Position
Unknown
AA seq 950 aa AA seqDB search
MLQKFVTGLAWASTVSGAALSRRQATSDSCPGYSASGVVQTATGLTADLTLAGAACNVYG
NDIQNLKLTVNYDSDSRLHVKIEDAANIAYRVPQSVFPTPDSNASVSAADSALEFSHVDS
PFSFKVTRKSSGEVLFDTSAASLIFEDQYLRVRTSLPENPNIYGLGEHSDSLRLNTTDYT
RTLWSRDSYGIPAGTNLYGNHPIYFDHRGSSGTHGVFLLSSSGMDVKINRTQTDGQYLEY
NLMSGILDFYFIDGPSPKQVAEHYSEVSGKAAMMPYWGFGFHQCRYGYRDYFAIAEVIAN
YSKADIPLETMWTDIDYMYERYIMTTDPDRFPIARVREYVDYLHAHNQHYIVMVDPAMAF
QTKRENDLPYQTFLRAQEQGILLQKNGADYQGVVWPGVTAFPDWFHPDTQSYWNNEFLEF
FNAETGMDIDALWIDMNEAANFNYFGDNPQDSAEERGFPPRRPALRSQPRPIPGFPQAFQ
PDPNSPYAPDDYSYAPPWLAPPATPNEKRSSKRTPLEANMLENRQASQVIGYPNRNLLAP
PYQINNENTVEAYGGLSNFTLDTDIIHYDGHVELDVHNIYGAQMSEFSRNALEARRPGRR
PMVITRSTFAGSGKAVGKWLGDNLSTWELYRQSIQGMLDFAAIYQMPMVGSDVCGFGANT
TETLCARWATLGCFNPFFRNHNGDSSIPQEFYLWDTVAEAARKTMSIRYRLLDYIYTALY
KQSTIGTPLINPMFFTYPEDEKTFAVELQFFYGEHILVSPVTEENSTSVDIYLPNDLFYD
FYTYAPVQGTGAMLTLNDIDFTSIPLHIKSGAVIPMRSESGYTTTDVRTKPFSFIVAPTA
AGEAAGELYLDDGDSIVQHETSEIKMTYHEKMLTIDGNFSYQAGCDSLQDVTILGVHTAP
TGAYWSKGSDAHEVVWYTCPAGGWKHDAEKESLTITIETKLDAPIKVKYE
NT seq 2853 nt NT seq  +upstreamnt  +downstreamnt
atgcttcaaaaatttgtgactggacttgcgtgggcaagcactgtcagcggtgcggccctc
tcacgtagacaggccactagcgatagctgccctggctattccgcatcaggtgttgtacaa
actgcaacagggcttaccgcggatttaacacttgctggcgctgcgtgcaatgtctatgga
aatgatatccaaaacttgaagcttactgtcaattatgattctgactcccgacttcacgtc
aagatcgaagacgctgcaaacatcgcataccgcgttcctcagagcgtctttccaacccca
gactcaaatgcatctgtctctgcagcagactctgcacttgagttctcccatgtcgattcg
ccattcagcttcaaggtgactcgcaagtcgtctggcgaagtgctgtttgatacttccgca
gcgtcattgatttttgaagatcagtacttgagagttcgaacttctctcccagagaacccc
aacatctatggacttggcgagcactccgacagtcttcgtctaaacaccaccgattacacc
agaacgctttggtcccgtgattcttatggaattcctgcaggaactaacttgtacggaaac
cacccaatctactttgatcatcgcggtagcagcggaacccatggtgttttcttactctcg
tcatccggtatggatgtcaagatcaaccgaacacagacggatggccagtacctcgaatat
aatttgatgtctggtattcttgatttctacttcatcgatggaccgtcgccaaagcaagtc
gccgagcactacagcgaggtgagtggtaaagccgccatgatgccatactggggtttcgga
ttccaccaatgccgatatggatacagagattactttgctatcgcagaagtcatcgccaac
tactcgaaagccgatattcctttggagacaatgtggactgatatcgactacatgtacgag
agatacatcatgaccactgatcctgatcgattccctattgcacgcgtccgtgagtacgtc
gattacctacacgcacacaaccagcattatatcgtcatggttgaccccgccatggctttc
caaactaagcgtgagaacgatctaccataccagacatttctccgagctcaagagcaagga
attttgctgcagaagaatggtgcggattatcaaggagttgtctggccaggtgtcactgcc
ttccctgattggttccacccagacacacaatcttactggaacaatgagttcctcgagttc
ttcaacgccgagacaggaatggacattgacgctctttggattgacatgaacgaagcggct
aacttcaactattttggagacaatcctcaggatagtgccgaggaacgtggattcccacca
cgtcgacctgctctgagatctcagccccgtcctattccaggattccctcaagcgttccaa
ccggatccaaactcgccttacgcaccagatgattacagctatgccccaccttggcttgca
cctcctgccacccctaacgagaagcgatcatccaagcggacaccactagaagccaatatg
ctcgaaaatcgtcaagcgagtcaggtaatagggtacccaaacagaaatcttcttgctcct
ccatatcagatcaacaacgagaacactgttgaggcatacggaggattatcaaacttcacc
ttggataccgatatcattcattacgatggccatgtagagctcgatgtccacaatatctat
ggtgctcagatgagcgaattttcccgcaatgcacttgaggctcgtcgtccgggtagacga
ccaatggtcatcactcgatctactttcgcgggcagtggaaaggctgttggtaaatggctt
ggagacaacttgtccacctgggagttgtatcgccaatcgattcaaggaatgctcgatttt
gcagccatttatcaaatgccaatggttggtagtgatgtctgtgggtttggtgctaacacc
accgaaactctttgcgcaagatgggcaactttgggttgtttcaatcctttcttccgcaac
cataatggtgacagctctattcctcaagaattctacctctgggatacagttgcagaggct
gctcgtaagactatgagcattcgatacagattgcttgattatatctatactgctttgtac
aagcagtctaccatcggaacccctctgatcaacccgatgtttttcacctatcccgaggat
gaaaagacgtttgccgttgagctccaattcttttatggtgaacacattcttgtctcaccc
gtcaccgaggagaactctacatcggttgatatctatctacccaacgacctattctacgat
ttctacacctatgcgcccgttcaaggtactggtgcgatgttgactctcaacgatatcgac
ttcacctctattcctcttcacataaagagtggcgcggttattccaatgcgcagtgagtct
ggttacaccaccacagatgtacggaccaagccattttctttcatcgtcgcaccaactgca
gctggagaagcagcaggcgagctctatctcgacgacggtgacagcattgttcaacatgag
acttctgagattaagatgacatatcacgagaaaatgcttaccattgatggcaacttttca
taccaagcaggatgtgactcgcttcaagacgtcactattcttggggttcatacagctcca
acaggtgcttactggtctaagggctcggatgctcatgaggttgtttggtatacttgtcct
gcgggaggatggaagcatgatgctgagaaggagagtcttacgattacgattgaaacgaag
ttggatgcacctattaaggttaagtatgagtag

DBGET integrated database retrieval system