KEGG   Glarea lozoyensis: GLAREA_08846Help
Entry
GLAREA_08846      CDS       T04883                                 

Definition
(RefSeq) SET
  KO
K11419  histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
glz  Glarea lozoyensis
Pathway
glz00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:glz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    GLAREA_08846
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:glz03036]
    GLAREA_08846
Enzymes [BR:glz01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     GLAREA_08846
Chromosome and associated proteins [BR:glz03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     GLAREA_08846
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    GLAREA_08846
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET SAP18
Motif
Other DBs
NCBI-GeneID: 19467894
NCBI-ProteinID: XP_008075998
UniProt: S3EEL9
LinkDB All DBs
Position
Unknown
AA seq 223 aa AA seqDB search
MINPDAHVYETIDGENFMSHQYLNTRDPIYECHQACSCDTACPNRVVEHGRTVPLQIFRT
DDGRGWGVRSPQDIRKGQFVDRYVGELITAEETERRRQRSDIAAKKDVYLFELDKFKDDA
DRDPTLAETVFVDGEYASGPSRFINHSCDPNLRIFARVGDHATKRFHDLAFFAVRDIPAD
TELTFDYVDGEDEKLEEEKKNPNQKKEMTKCLCRSRKCRGYLW
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgattaaccctgatgctcacgtttacgagaccattgatggggagaacttcatgagccac
cagtatctaaacactcgcgatccgatttacgagtgtcaccaagcttgtagttgtgacacc
gcatgtcctaatagagtagtggagcatgggagaactgttccgttacaaatcttccgtact
gatgatggacgcggatggggtgttcgctcgccacaagacataagaaaggggcagttcgtc
gacagatatgtaggagaactaattaccgccgaggagaccgagagacgacgccaaagatca
gatatcgctgccaagaaggacgtctacctcttcgagcttgacaagttcaaggatgatgca
gaccgcgatcccaccttagccgaaacggtcttcgttgatggagagtacgcatccggacca
agtcgttttatcaatcactcttgtgatccaaatcttcgcatcttcgcccgagttggagat
cacgccacaaagcgattccacgatctggccttctttgctgtcagagatatcccggctgat
accgagctgactttcgattatgttgatggtgaagacgagaaactagaagaggaaaagaag
aatccgaatcagaagaaagagatgacgaaatgtctatgtagatctaggaagtgtcggggg
tacctgtggtag

DBGET integrated database retrieval system