KEGG   Glarea lozoyensis: GLAREA_09240Help
Entry
GLAREA_09240      CDS       T04883                                 

Definition
(RefSeq) Arginase/deacetylase
  KO
K11484  histone deacetylase HOS3 [EC:3.5.1.98]
Organism
glz  Glarea lozoyensis
Brite
KEGG Orthology (KO) [BR:glz00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:glz03036]
    GLAREA_09240
Enzymes [BR:glz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     GLAREA_09240
Chromosome and associated proteins [BR:glz03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     GLAREA_09240
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 19468288
NCBI-ProteinID: XP_008076392
UniProt: S3DF77
LinkDB All DBs
Position
Unknown
AA seq 1206 aa AA seqDB search
MASNGSPKTSSTINKEPTNFQNTLKRFSTINTSESIASPSSPQPSSPRNLGPRNYSPSPN
GRIPSRSPNPRSPSAMSSLDARSSTPSLLRKASMNSLHGVSGVTPPRSSPSRASPSRSSS
AQYKNGRSPLAEMEQEIPAPPRHTAASIAHNHFEKEMELHRREDVTRHADTIAILHDSCY
GHRFSRPKTSRASLLTIVERPERIQASVLGLSVAYVRLGEQHSEGAYPLHPSQDPSSIPS
GPFRIRKTSRKLPLNSPAVTNVHGVKWMEELKIMCDAAEGRLAMNGKELARPDMARGAGE
EAPQKFHEGDLYLCAESLDAMEGALGAVCEGVDAIFEGSASGRGPHRAFVTIRPPGHHCS
ASYPSGFCWLNNVHVGISHATLAHGLTHAAIIDFDLHHGDGSQAIAWEHNARANTAAKNA
APWKKTSIGYFSLHDINSYPCEYGDEEKIKNASLCIENAHSQSIWNVHLQPWKSEAEFWE
LYETKYSILLEKTRNYLRAQTERFQANHNGPKPKGAIFLSAGFDASEWESSGMQRHKVNV
PTEFYARLTRDVVKIAAEEGTSVDGRVISVLEGGYSDRALYSGVLSHVSGLAGGAPMLVK
KEPEVGGLGYEMGQKIGVFNGVDNERGKPFISQVPEYDPLWWSLPRLEQLDLTVNGAPAP
EERAPREGPAPTYSTPTQSFIAKVVSPSARRSVSSMSVGSPRAYARPPSPPPPEVHWTVA
AHELSKILIPSDRQVGSCKPEDLSAEATRARRDRQSILVGSSEAPVVEAPPVPANARMSL
RTRKPGKAIIEEDEEVKKPKTSRRRTVAGGTTLATEKAASRNITPIVPPLPSYSRPTSQS
ARRLSLVSNGSMTSDTSSRIPRAPSNGVPSVYPRPDTSQSIRPESSMSSRGHSIPPVVVK
KTRAPAQPRAEPAKSSRIRRTSPLNGLASSIEQDESDPAAPKSHGNGVTAHSAAQPSAMD
SLTSGMQKVKISLTTKAQREAKEGKAVKEPKELVKRAPKTTKRAPAKASKPQSIEIPAQA
AQSAQSAQPQAPAVSTPVIKHEDQETLPDLNSIPEPSPKLPSTPLASLRPHFPIHVPQPS
DIPLPASSPAGQLSSIPSLTSPSTSLPTSSVTTPDQGTNIFIPYQPEGPTPDAIPRNQAI
HFLPPNTNTPSPMKRADLPVFTSTSRIQFAPNPNVPMPVPETKEERVEEVEGKDVDMWEV
PETPEK
NT seq 3621 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccaatggctccccaaaaacatcgtcaacaatcaacaaagaaccgacaaacttc
cagaacacactgaagcgcttttccacaatcaacacttccgaatctattgcctcgcctagc
tctcctcaaccgtcgtctcccaggaatttaggtccgcgaaattacagcccgtcgccaaat
gggagaataccctctcgaagtcctaatccacgcagccccagtgccatgagcagcttggat
gcgcgatcttcaacaccaagtttactgcgcaaggcttctatgaactctttgcacggagtc
agcggcgtcactcctcccagatcttctccctcacgagcatcaccttctagatcctcatcg
gcgcaatacaagaacggtagatcacccctcgccgagatggaacaggaaattccagcgccg
ccgcggcatacagcagcctcgatcgcgcataaccattttgaaaaggagatggaacttcat
aggagggaggatgttacgagacatgcggatacaattgctattctacacgattcttgctat
ggacatcgcttctcgagaccgaaaacatcgcgggctagtctcctcacgattgtagaaaga
ccggagcgcatacaggcgagtgtacttggattatctgtggcatatgtacggcttggagaa
caacattcagaaggagcttatcctttgcacccttctcaggacccctcctcgattcccagt
ggcccttttcgaattcgtaaaacgtcacgcaagctaccacttaactctcctgcggtcaca
aatgttcatggggtaaaatggatggaggagttaaagatcatgtgtgatgctgcggagggc
agactggccatgaatgggaaggaactggctcgacctgatatggcccgtggggcaggagaa
gaagcgccgcaaaagttccacgagggagatctttacctatgcgctgagtctttggatgct
atggaaggagcactaggtgctgtatgtgagggtgtagacgccatattcgaaggatcggca
agtggaaggggaccgcatcgtgcgtttgttactatcaggcctccgggacatcactgttcg
gcaagctacccttctgggttttgttggctgaataatgttcatgttggaatttcacacgca
acgctcgctcatggtctaacgcacgctgcgattatcgatttcgatcttcatcatggagat
ggctcgcaagcgattgcgtgggagcacaacgctcgagctaataccgcggccaagaatgcg
gcgccttggaagaagacatcaattggatattttagtcttcatgatattaattcatatcct
tgtgagtacggagatgaggagaagattaagaatgctagtctttgcatagagaatgctcac
agtcagagtatctggaacgtacaccttcaaccatggaagagcgaggcggagttctgggaa
ttgtatgaaaccaagtactcaatccttttggaaaagaccaggaattatttgcgagctcag
actgagcgtttccaggcaaaccataatgggccaaaaccaaagggtgctatatttctctcg
gctggttttgatgctagcgagtgggagagttctggtatgcaacgtcacaaagttaatgtg
cctacagagttctatgcccgtctcactcgggatgtagttaaaattgcggctgaagaaggg
acatcagttgacggcagggtaatcagtgttctcgaaggtggctacagcgatagagctttg
tacagtggtgtcctcagccatgtcagtggtttagcaggtggcgcaccaatgcttgtcaaa
aaggagcctgaagttggcgggcttggctatgaaatggggcagaagattggtgtcttcaat
ggggttgacaatgaacgtgggaaaccttttatatctcaagttccagaatacgatcctctc
tggtggtcgctacctcgacttgaacagctggatctgacagtcaatggagcaccagcaccc
gaggaacgagcacctcgtgaaggaccggctccaacatattcaactccaacccagtcattc
atagccaaggtcgtatctcctagcgctcgtaggagtgtatccagtatgtctgttggctct
ccccgagcatacgcaaggccaccaagtccacctccgccagaagttcactggacggttgct
gcgcacgaactgagcaagattcttattccatcggataggcaggttggtagttgtaagcca
gaagacctgtctgctgaggcaacccgcgctcgaagggatcgacagtctattttggtagga
tctagtgaagctcctgtagttgaagcgccgccagttccagccaatgcaagaatgtctctt
cgcaccaggaagccagggaaggctattatagaggaggatgaagaggtgaagaaacccaag
acaagccgccggaggactgttgcgggtggaacaaccttggcaactgaaaaggctgcttcc
agaaacatcacacctattgttccacctctaccaagttattcaaggccgacaagtcagtca
gcacgaagattgagcttagtatcaaatggttctatgacatcggatacctcctcgagaata
cctagagctccgtcaaatggagtaccctcggtatatcctcgacctgatacttcacaaagt
atcagacccgagtcgtcaatgagctctcgaggccattcgattccgccagttgtagttaag
aagacaagagctcctgcccaaccccgagctgaaccagctaaatcgtcgcgaattcgccgc
acatcgcctcttaatggtcttgcttcgtctattgagcaggatgagagtgacccagcggct
cctaaatctcatggtaacggtgtgactgcacactccgcagctcagccctctgcaatggat
agcttgacgtctggaatgcaaaaggttaagatcagtctgaccacaaaggctcagcgggag
gcaaaggaaggaaaggctgtgaaagagccaaaggaactggtcaaacgagcacccaaaact
acaaaacgggctcccgccaaagcttctaaaccccaatcaattgaaattccagctcaagcg
gctcagtcagctcagtcagctcaacctcaagcccctgcagtctcgacgccagtaatcaag
cacgaagaccaagagacgcttccagatctcaactccatcccagaaccatctccgaaactc
ccttcgacgcctctcgcttctctacgaccacacttcccaatacacgtccctcaaccatcc
gatatccccctccccgctagctcgcctgccggtcagctatcaagcatcccctctcttacc
tcaccatccacatctctaccaacctcctcagtaacaactcccgatcaaggaacgaacatt
ttcatcccctaccaacccgagggaccaactcctgatgctataccaagaaatcaagctatc
catttcctgcctccaaatacgaacacgccttcccctatgaaacgagctgatctaccggtt
ttcacgagtacgtcgaggattcaattcgcccctaatcctaatgtcccgatgccggtaccg
gaaacgaaagaggaacgtgtggaggaggttgaagggaaggatgtggatatgtgggaggtt
ccggagactcctgagaaataa

DBGET integrated database retrieval system