KEGG   Glarea lozoyensis: GLAREA_09680Help
Entry
GLAREA_09680      CDS       T04883                                 

Definition
(RefSeq) Isocitrate/Isopropylmalate dehydrogenase-like protein
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
glz  Glarea lozoyensis
Pathway
glz00020  Citrate cycle (TCA cycle)
glz00480  Glutathione metabolism
glz01100  Metabolic pathways
glz01110  Biosynthesis of secondary metabolites
glz01130  Biosynthesis of antibiotics
glz01200  Carbon metabolism
glz01210  2-Oxocarboxylic acid metabolism
glz01230  Biosynthesis of amino acids
glz04146  Peroxisome
Module
glz_M00009  Citrate cycle (TCA cycle, Krebs cycle)
glz_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:glz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GLAREA_09680
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    GLAREA_09680
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    GLAREA_09680
Enzymes [BR:glz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     GLAREA_09680
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 19468727
NCBI-ProteinID: XP_008084467
UniProt: S3CU55
LinkDB All DBs
Position
Unknown
AA seq 413 aa AA seqDB search
MASGSKIKVKNPVVELDGDEMTRIIWKDIKDKFIHPYLDIDLKYYDLGLEYRDQTNDQVT
IDSAEAIKKYSVGVKCATITPDEARVKEFNLKQMWLSPNGTIRNALGGTVFREPIVIPRI
PRLVPGWKKPIIIGRHAFGDQYRAKDLVVPGNGKLSMVFTPEGGSPQEIEVYNFKNGGGV
AQTQYNTDDSITGFAHASFKLALSKSLPLYMSTKNTILKKYDGRFKDIFEEIFQKHYKKE
FDEKKIWYEHRLIDDMVAQMMKSSGGYIMALKNYDGDVQSDIVAQGFGSLGLMTSVLITP
DGKTFESEAAHGTVTRHYREHQKGNETSTNPIASIFAWTRGLIQRGTLDETPEVVAFAES
LEKACIDTVDIDGIMTKDLALACGKTGREDYVTTTEYLNAVERRMKSLLKTKL
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggcatctggcagcaagatcaaagtgaagaatccggtggtggagctcgatggagatgag
atgacgaggatcatctggaaggatatcaaggataaattcattcatccgtatttggatatt
gacctgaagtattacgatttgggactggagtatagggaccagaccaatgatcaggtcact
attgattcggccgaggcgatcaagaagtatagcgttggtgtgaagtgtgcgacgatcacc
ccggatgaggcaagagtgaaggagtttaacttgaaacagatgtggctctctccaaacggc
acgatcagaaatgctctcggcggaaccgtcttcagagaacccatcgtcatcccacgtatc
cctcgtctcgtacctggatggaagaagcccatcatcatcggtcgacacgcattcggagac
cagtaccgcgcaaaggatctagtggtaccaggcaatggaaagctctccatggtattcaca
cctgagggtggctcacctcaagagattgaggtctacaacttcaagaacggaggaggtgtt
gcgcagacacagtataacaccgatgatagcattactggattcgcgcatgcatctttcaaa
ttggcgttgagcaagagtttaccactttatatgagtaccaagaacaccattctcaagaaa
tacgatggaaggttcaaggacatcttcgaggagatcttccagaaacattacaagaaggaa
ttcgacgagaagaagatctggtatgaacacagattgatcgacgatatggtcgctcaaatg
atgaagagctcaggaggttacatcatggctttgaaaaactacgacggcgacgtccaatcc
gacatcgtcgcccaaggcttcggctccctaggcctcatgacctccgtcctcatcaccccc
gacggaaagaccttcgaatccgaagccgcccacggcaccgtcacacgacactatcgcgaa
caccaaaaaggtaacgaaacctccaccaaccccatcgcctccatcttcgcctggacacgc
gggctcatccagcgcggaaccctcgatgaaacgcccgaggtcgtggcgttcgccgagagt
ctcgagaaagcgtgtatcgataccgtggatatcgatgggatcatgacgaaggatctggcc
ttggcgtgtggcaagaccgggagagaggattatgttactacgactgagtatttgaatgcg
gtggagaggaggatgaagagtttgttgaagactaagttgtag

DBGET integrated database retrieval system