KEGG   Glarea lozoyensis: GLAREA_10627Help
Entry
GLAREA_10627      CDS       T04883                                 

Definition
(RefSeq) Six-hairpin glycosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
glz  Glarea lozoyensis
Pathway
glz00500  Starch and sucrose metabolism
glz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:glz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GLAREA_10627
Enzymes [BR:glz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     GLAREA_10627
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15 CBM_20
Motif
Other DBs
NCBI-GeneID: 19469673
NCBI-ProteinID: XP_008077919
UniProt: S3D8Z2
LinkDB All DBs
Position
Unknown
AA seq 615 aa AA seqDB search
MRFSSSVAGVLSLLCSQAVAFSLRGRDLESFIAAERAIALQGVLNNIGPDGSQVAGAGNY
IIASPSKEDPDYFFTWTRDAALTMQMIVDEFIFGNTALEKYIDEYIKAQAILQTVSNPSG
SLLPSGLGLGEPKYLANGQRFNGAWGRPQRDGPALRAIALMTYSDWLLRNGQSAKARNIV
WPVISNDLSYVGQYWNQTGFDLWEEVQGSSFFTVQNQHRSLVQGTKLARDLRVTCTGCDQ
APQVLCFLQSFWNGKYIVSNTNTNIARTGLDGNSILGPISVFDIDAYCDSLTFQPCNSKS
LANFKAVVDSFRTAYSINAGIPKNQGVAVGRYTEDVYYNGNPWYLITTAAAEFLYDAVAQ
WRARHVLYVDETSLAFFKDLYPDVVVRQYNSGNYNSPFEQIMRAVLAYADSFVAVAEKYT
PASGALAEQFNRDTGVPLSARDLTWSYAAFVTMAERRAGQYPRSWNTRQAAAPPATCSAS
STPGVYAPATAAGAPNVTIACQINVIFNVNASTYFGENVYIVGNTTELGEWNADVLNTAL
ALSAGGYSAERPLWSVNTFLPAGESISYKYARQENCGQPYLYETQNRTLTIPPCGGAAIT
VEDAWTGPVGTSGGC
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttctcatcttctgttgctggagtcctctctctcctctgctcacaagcagtagct
ttttcgctaagaggcagagatcttgagtcttttatcgctgctgagagggccattgctctt
caaggtgttctgaacaacatcggtccagatggatcgcaggtcgctggagctggcaattac
attattgcgagtccttctaaggaagacccagattacttcttcacatggactcgagatgct
gctctgaccatgcaaatgattgtggatgaattcatctttgggaacactgccctggaaaaa
tacattgacgagtacatcaaggctcaagccatactccagactgtcagcaacccatcagga
tctctcctcccaagtggtctcggccttggtgagccaaaatacctggcaaatggtcagcgt
ttcaacggagcctggggacgtcctcaacgggatggtccagcacttcgtgcaattgccttg
atgacctacagtgattggttactcagaaacggtcaatccgcaaaagctagaaacattgtc
tggccagtgatttccaatgatctctcatacgtaggccagtactggaaccaaactggattt
gatctttgggaagaagttcaaggatccagtttcttcaccgttcagaatcaacacagatct
ctcgttcaaggtaccaagcttgctagggacctcagagttacctgcactggatgtgaccaa
gcaccacaagtattgtgcttccttcaaagcttctggaatggcaaatacattgtttcaaac
accaacaccaatatcgcccgtactggtcttgacggaaattccatccttggtccaatctcc
gtcttcgatatcgatgcgtactgcgacagtttaacattccaaccttgtaactcaaagtca
ttggccaacttcaaggcagtggtcgatagcttcagaacagcctactccatcaacgctggt
atcccaaagaaccaaggtgtagcagttggacgttacactgaagatgtctattacaacgga
aatccatggtatctcatcactactgccgccgccgagttcctctatgatgccgttgctcaa
tggcgtgctagacacgttctctacgtcgacgagacctccctcgcattcttcaaagacctc
tacccagacgtcgtagtccgccaatacaacagcggaaactacaacagtccattcgagcaa
atcatgcgcgccgtcctcgcctacgccgactcctttgtcgccgtcgctgaaaaatacaca
cccgcctccggggccctcgccgaacaattcaaccgtgacaccggcgtccctctctcagcc
agagacctcacctggtcttacgccgccttcgtaaccatggcagagcgtcgcgccggtcag
taccctcgctcttggaacacccgtcaagcagccgcaccaccagcaacctgctctgcctcc
tcaaccccaggcgtctacgctcctgccaccgcagcaggcgcgccaaatgtcaccatcgcc
tgccagatcaacgtcatcttcaacgtcaacgcctcgacctactttggcgaaaacgtctac
atcgtcggtaacaccaccgagctcggcgagtggaatgctgatgtcctgaacacggcgctg
gcgctcagtgcgggtggttactcggcggagagaccgctgtggagtgtcaatactttcttg
ccggctggtgagagcatcagttataagtatgcgcgacaggagaattgtggacagccgtat
ctttacgagacgcagaatcgcacgctgacgattccgccgtgtggaggggcggctattacg
gttgaggatgcgtggacgggaccggttgggacgtcggggggttgttga

DBGET integrated database retrieval system