KEGG   Glarea lozoyensis: GLAREA_11249Help
Entry
GLAREA_11249      CDS       T04883                                 

Definition
(RefSeq) Thioredoxin-like protein
Organism
glz  Glarea lozoyensis
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_5 Glutaredoxin GST_C_2 GST_N_4 GST_C_3
Motif
Other DBs
NCBI-GeneID: 19470291
NCBI-ProteinID: XP_008077629
UniProt: S3DCT6
LinkDB All DBs
Position
Unknown
AA seq 670 aa AA seqDB search
MDPLHHQFSSLQPQATRDLQHGHGQQHLSHHALTSQTAGLDLSGLDDTDHVYQELNRMQD
GHAAFQSQNPFERNHLHAPLHDHSPLHAGHTLHDSHPPHTTLHDSHPPLHDPHPPLHDSH
PPLHDNQTSLHDDHASIHIQNNGSPHPLPHTPQHSNGGQFGMLTGGPVQHNAISRLQEEE
LFGPPPPVPEGSDQQSNGHQSNRLVDNPPNLDEWRQKLFDVDQMITLSEDEYNTYFPHVD
NVYSHRSTQKYKKKPFVSHYWDCRLKGRPPGTPKSDDPNKKKRKRTARERDLCDVKIKIT
EYFPGALQQAGFEPENGGQPASSNGFFGSNEAAQGSQFGVSIVNPTHPASHPGANSARYY
TIQRVNGNGGNGKGDGVPGPHKHDLAESDRVKKNSVQRMMSKKEKEDKKQQKTYHKKASG
TALMTVKKHSKDHELKLYGSCHCPFVQRVWIALEAKGVPYQYVEVDQLKKPQALLDISNA
GLVPALRSNNFSMSDSTVLLEYLEDSMPNVAPMMPPHPQDRAIARLWASHIDRKIIPAFY
SLLLNQDFAKQAEYTKKLQDVIQTLVHSSDAIGPFFMGPYLSYVDVMFAPWMLRLSRVMK
HYRGWQDPVGGTRWAAWMDAIETNEHIRNTTSSDDLYIDSYEPYAQNRTGTTGLADITNG
GINLTLPAGH
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atggatcctctacatcaccaattcagtagcctccaaccacaagctactcgagatctccag
catggccacggccagcaacacctctcccatcatgccttgacctcgcaaaccgccggtttg
gacctcagcggtctcgacgatacggaccatgtttaccaggagctgaatcgcatgcaggat
ggacatgctgctttccagtcgcaaaaccccttcgagagaaaccatctacacgcgcctctc
catgaccattcccccctccatgccggccatactcttcacgacagtcaccctcctcacacg
acccttcacgattcacaccccccgcttcacgatcctcatcctcccttacacgactcacat
cctcctctgcacgataaccagacttctctccacgatgaccatgcctcaatccacatccaa
aacaatggcagccctcacccgctgccccataccccacaacatagcaatggcggtcagttc
ggcatgttgactggaggtccagtccagcacaatgcgatcagccgactccaagaagaagag
ctatttgggccaccccctccggtacctgagggttccgaccagcagagcaacggccaccaa
agtaatagactggttgataatccaccaaatctggacgaatggcgacagaagctctttgac
gttgatcaaatgattactttaagcgaggacgaatacaacacatatttcccccatgtcgat
aacgtttactctcatcgatccacgcaaaagtacaagaaaaagcccttcgtatcacattat
tgggattgtcgtctgaagggacggccaccaggaacgccaaagtcagatgatccaaacaaa
aaaaagcgcaagaggacagctcgcgagcgtgatctctgtgatgtcaagatcaagattacc
gaatacttccccggtgccttgcaacaagctggattcgagccggaaaacggtggtcagccg
gcttcaagtaatggcttctttggatcaaatgaggccgctcaaggttcccaatttggcgtg
tctattgttaatccaacccatccagccagccacccaggtgcgaatagcgcgcgttattac
actatccagcgtgttaatggcaatggtggcaatggcaagggcgacggtgttccaggacct
cacaaacacgaccttgccgagagcgatagagttaagaaaaacagcgttcaacgtatgatg
tctaagaaggagaaggaagataaaaagcagcagaaaacataccataagaaggctagcggc
actgccttgatgaccgttaagaaacactccaaggaccatgaactcaagctttatggtagt
tgtcattgcccttttgttcagcgagtctggatcgcgttagaagccaaaggggtcccttac
caatacgtagaggtagaccaacttaaaaaaccacaagctcttctagatattagtaatgct
ggattggtgcctgcgttacgcagcaataatttcagcatgagtgacagcacagtcctcctc
gaatacctagaagactctatgcccaatgtcgccccgatgatgccaccccatccccaagac
agagccatagctagactttgggccagtcatattgatcgaaaaattatacccgcgttctat
tcccttttactgaatcaggattttgccaaacaagccgagtacacaaagaaactccaagat
gttattcagacgcttgtgcattcgtcggatgcaataggcccgtttttcatgggcccatac
ttgtcttatgttgacgttatgtttgctccttggatgctcaggctttcaagagtcatgaaa
cattacagaggttggcaagatcccgttggtggcactcgatgggcagcctggatggacgct
atcgagactaacgaacacattcgtaacacaacatcatcggacgatctttacattgacagc
tatgaaccttacgcacagaatcgtactggcacgaccggccttgctgacataacgaatggt
gggatcaatctaaccctaccggcaggacattaa

DBGET integrated database retrieval system