KEGG   Granulicella mallensis: AciX8_0680Help
Entry
AciX8_0680        CDS       T01664                                 

Definition
(GenBank) translation initiation factor IF-2
  KO
K02519  translation initiation factor IF-2
Organism
gma  Granulicella mallensis
Brite
KEGG Orthology (KO) [BR:gma00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:gma03012]
    AciX8_0680
   03029 Mitochondrial biogenesis [BR:gma03029]
    AciX8_0680
Translation factors [BR:gma03012]
 Eukaryotic type
  Initiation factors
   MTIFs
    AciX8_0680
 Prokaryotic type
   AciX8_0680
Mitochondrial biogenesis [BR:gma03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    AciX8_0680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IF-2 GTP_EFTU IF2_N MMR_HSR1 GTP_EFTU_D2 MMR_HSR1_Xtn RsgA_GTPase Ras Roc ThiS Arf GTP_EFTU_D4
Motif
Other DBs
NCBI-ProteinID: AEU35030
UniProt: G8NR45
LinkDB All DBs
Position
complement(787238..790465)
Genome map
AA seq 1075 aa AA seqDB search
MSKVRINDLARELEVKSKPILDALIAVGVTEKKTHSSSIEEDEAEKVRAYFNRGARSAAT
KPMAETKPAFNLANVSKPGDALKAILERKQAEAAAKAAPPPQRPAVAVAAPVSAAPVVAV
ARPATPPPVAVVAAPAPPVTVVAAPPPPPTPTPAPAPTPTPAATTPSGAPAPRRIVPLPR
GAGPVIVAPPRPAGSPLISRPAVATPPPAVASTPPATPVVVRPAAVPTPPPAPVVAAAAP
AQPVTPLSDPEPPAAPAAVVETAAVEAAAPVPEAAPAAPAVPVRRVVMPQTGPRPSYTAP
AVMPGAVRRPIFERPRPGSGPAGSGGPGGPGSRPMAPGARRPMHPTRTFPGGPGGGPGAP
GARPGFAPGGRPGFPPRPGFGPRPGGPGGMLPPAEGAPAPARPARPGQRGRGGPRYEKNK
EVALKGYNPRFGAPQIPMGEVPITKTITVTEGISVKDLAEKLDIRGKDLIATLLMKGVMV
TVNQSLDGELVKEVSRQFGADATVITVEEQLENEAIEGFLEDTSNMVEVVRAPVVTIMGH
VDHGKTSLLDAIRSTDVAAGEAGGITQHIGAYKVHVTKPDSPAFGREIVFLDTPGHEAFT
RMRARGAKITDIVVVVVAADDGVMPQTLEAIDHANAAKVPIIVAVNKIDKPEADPSKVMM
QLAARGIQAKSLGGNTEFVEVSAKKRLHLDDLEEMICFVADSNEQKAQPERPAVGTVIEA
KLDRGRGAVASILVQNGTLKIGDSYIVGNTFGKVRAMFNDRGQAITEAGPSTPVEILGLE
SIPDAGDTFLVMADRDKAKGIAQYRKMKEREAQLAKSSRVSLEGLAEQIKQAGVKDLNLI
LKGDVQGSVEVLADSMQRMSTEKVRVKVLHSGVGAITESDVLLASASNAVIIGFNVRPDR
KSAEVAERENVEIRLHSIIYELQDEITKAMFGLLEPVYKENYAGRAEVLQVFKITKVGQI
AGCVVRDGIIKRDAQVRVLRNGEEVWKGKISSLKRVKDDVSEVRQGVECGIDLAGYKDIK
SGDIIEAFTTEKLAAELGQNSAEAKKERDLAALKEAKDRENEVARAERETEAANA
NT seq 3228 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaagttcgaattaacgatcttgcacgggaactggaagtaaagagcaaaccgatt
cttgatgctctgatagcggtaggcgttaccgagaaaaagacgcattcgagctccatcgaa
gaagatgaagctgagaaggttcgcgcgtacttcaatcgtggtgcacgctccgcagcgaca
aagcctatggccgagactaagcctgccttcaatctcgcgaacgtctccaagcccggcgat
gcgctgaaggctattctggagcgcaagcaggctgaggctgccgcaaaggctgccccaccg
ccacagcgtcccgcagtggcagtggccgctcccgtttccgcagcccctgtcgtagccgta
gcgcgtcctgccacaccgccccccgtggcggttgtcgccgctcccgcacctccggttaca
gtagtcgcggccccaccaccacctccgacgccgacgccagctcccgcgcccacacccacg
cctgcagcgacaaccccttcgggcgctccagccccacggcggatcgttcccttgcctcgc
ggggcaggtcctgtcatcgtggctccgcctcggcccgcaggcagccccctcatatccaga
cccgctgtcgcgacacctccgccagcggtggcttccacgccgcctgccactccggttgtc
gtgagacccgctgccgttcccacaccgccaccggcacccgtggtggcagcagcagcccct
gcgcagcctgtcacacctctctctgaccccgagccaccagcagcaccggcagccgtcgta
gagactgcagctgtagaagctgccgcgcccgttcccgaggcagcacctgcggctcccgca
gttccggttcgccgcgtcgtcatgccgcagaccggtccccggcccagttacaccgccccg
gcggtgatgcctggcgctgtccgtcgccccatcttcgagcgtccgcgccccggcagcggt
cctgctggatcgggcggccctggtggtcccggctctcgtcccatggctcccggcgcccgg
cgcccgatgcaccccacccgtaccttccccggcggtcccggcggaggccctggtgctccg
ggtgcacgtcccggctttgctcccggcggccgtcctggcttcccaccgcgtcccggcttc
ggcccacgccccggcggtcccggcggcatgctgcccccggctgaaggcgctccggcaccc
gctcgtccggctcgtcccggccagcgcggccgcggcggtccacgctacgagaagaacaag
gaagtcgccctcaagggttacaacccacgcttcggcgcgccccagatcccgatgggcgag
gtgccgatcaccaagaccatcacggtcaccgaaggcatctcggtcaaggatctcgctgaa
aagctggacatccgtggcaaggacctcattgctaccctgctgatgaagggtgtcatggtc
accgtcaaccagtcgctcgacggcgaactggtcaaggaggtctcacgccagttcggcgcc
gatgccaccgtgatcacggttgaagaacagcttgagaacgaggccatcgagggcttcctc
gaagacacctcgaacatggtcgaagtcgttcgcgctccggtggtcaccatcatgggtcat
gtcgaccacggtaagacctccctgctcgacgcgatccgctccacggacgtggcggcaggc
gaagccggcggcatcacccagcacatcggtgcctacaaggttcacgtcaccaagcccgac
tctcccgcctttgggcgcgagatcgtcttcctcgataccccgggccacgaggccttcacc
cgtatgcgtgctcgcggcgccaagatcaccgacatcgtcgtggtcgtggtcgcagccgac
gacggcgtgatgccccagacccttgaggcgatcgaccatgccaacgcggcgaaggtaccc
atcatcgttgcggtcaacaagatcgataagcccgaagcggatccgagcaaggtcatgatg
cagctggcggcacgcggcatccaggccaagtcgttgggcggcaacaccgagttcgtcgaa
gtctccgcgaagaagcgcctccacctcgatgacctcgaggagatgatctgcttcgtcgcc
gacagcaacgaacagaaggcccagccagagcgtccggcagtcggtacggtcatcgaagcc
aagctcgatcgcggccgtggtgcggtcgcctccatcctggtgcagaacggcacgctgaag
attggcgacagctacatcgtcggcaacaccttcggcaaggtccgcgccatgttcaatgac
cgtggccaggccatcaccgaagccggtccctcgaccccggtcgagatcctcggactcgag
tcgattcccgatgcgggcgacacgttcctcgtcatggcggaccgcgacaaggccaagggt
attgcgcagtaccgcaagatgaaggaacgcgaagcacagcttgccaagagctcgcgcgtg
tctctcgaaggcctcgccgaacagatcaagcaggcaggcgtcaaggacctcaacctcatc
ctcaagggcgacgtgcagggctcggtcgaagtactggccgactcgatgcagcgcatgtcc
accgagaaggtacgggtcaaggtgctgcactcgggcgtcggtgctatcaccgagtcggac
gtgctgctggcctccgcgtcgaacgctgtcatcatcggcttcaacgtgcggcccgaccgc
aagtcggccgaagtcgccgagcgcgagaacgtcgagattcgtctgcactcgatcatctac
gagttgcaggacgagatcaccaaggcgatgtttggcctgctcgagccggtctacaaggag
aactacgctggccgcgccgaagtgctacaggtcttcaagatcaccaaggtcggccagatc
gccggctgcgtggttcgggacggcatcatcaagcgcgacgcccaggtacgcgtgctgcgc
aacggagaagaggtctggaagggcaagatctcctcgctcaagcgcgtcaaggacgacgtc
agcgaagtccgccagggtgtcgagtgcggtatcgatctcgccggctacaaggacatcaag
tcgggcgatatcatcgaggccttcaccacggagaagctggctgcagaactcggccagaac
tccgcggaagccaagaaagagcgcgacctggctgccttgaaggaagccaaggaccgcgag
aacgaagtagcccgcgctgaacgggagaccgaagccgctaacgcgtaa

DBGET integrated database retrieval system