KEGG   Granulicella mallensis: AciX8_1351Help
Entry
AciX8_1351        CDS       T01664                                 

Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
gma  Granulicella mallensis
Pathway
gma00040  Pentose and glucuronate interconversions
gma00051  Fructose and mannose metabolism
gma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AciX8_1351
   00051 Fructose and mannose metabolism
    AciX8_1351
Enzymes [BR:gma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     AciX8_1351
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 2-Hacid_dh_C ADH_N_2 F420_oxidored
Motif
Other DBs
NCBI-ProteinID: AEU35694
UniProt: G8NZ42
LinkDB All DBs
Position
1571242..1572321
Genome map
AA seq 359 aa AA seqDB search
MSRTMQAAVYRAPDDVRTETIAVPEIGSGEVLVRIDTCGICGTDLKKIHTGSHSAPRVFG
HEMAGTIAAVGEGVHGFAVGDRVMAFHHIPCGQCFYCRKQTFAQCERYKLVGTTAGLGAA
AGGGFAQYIRVMDWIVGDGVTPAGLIRIPDDIPFEQAAFIEPVNTCFKAIQLLHLEQDDT
VLVIGQGSIGILLAALARQTGATVLTSDMYAERHAIAAKFGLDHPLDARGDVVAAAKAAT
EGRGADVALVAVGADALIATAMQAIRPGGRVMLFASTQHGTAPFDPAAVCMDEKTLMGSY
SASVAIQQEGIDLVFEGYRSGKLDLTQLISHRFSLDDAASAVHLASNPQPDSMKIVLKP
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgtaccatgcaagccgctgtttatcgtgctcccgatgatgttcgtacagaaacg
attgctgttcccgagataggttcgggagaggtgcttgttcgcattgatacctgcggtatc
tgcggaacggaccttaagaagatccatacaggctctcactccgcaccgcgtgtcttcggg
catgagatggcggggacgattgcggctgtgggcgaaggcgtgcatgggtttgctgtgggc
gaccgcgtgatggcgtttcaccatattccgtgcggacaatgcttctactgccgcaagcag
acctttgcgcagtgcgagcgctacaagctggtaggaacgacggcaggcctgggcgctgcg
gcgggcggcggttttgcgcagtacatccgcgtgatggactggatcgtcggcgatggcgtg
actcctgccggattgatcaggattcccgacgatattccgtttgagcaggctgcgtttatc
gagccggtcaatacgtgcttcaaggcgattcagctcttgcatcttgagcaggacgatacg
gtgctagtgatcgggcagggaagcatcggcatcctgctggccgcgctagcgaggcagacc
ggggcgacggtgctgacctcggatatgtatgccgagcgtcatgccattgcggcgaagttt
gggctggaccatccgctggatgcgcgcggcgatgttgtggcggcggcgaaggcggcaacc
gaaggccgtggcgccgatgtggccctggtggcagtgggcgcggatgccctgatcgcaacg
gcgatgcaggcgattcgtcccggcggccgtgtgatgctcttcgcgagcacgcagcatggg
acagctcccttcgatccggcagcggtctgcatggacgagaagacgctgatgggttcttat
tctgcgtcggtggcgattcagcaggagggaatcgatctggtgtttgaaggctatcgctcg
ggcaagctcgatctcacgcagttgatctcgcaccggttctcgctggacgatgccgcctcg
gcggttcacctggcgtcgaacccgcagccggattcgatgaagattgtgttgaagccctag

DBGET integrated database retrieval system