KEGG   Granulicella mallensis: AciX8_2530Help
Entry
AciX8_2530        CDS       T01664                                 

Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
gma  Granulicella mallensis
Pathway
gma00564  Glycerophospholipid metabolism
gma01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gma00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AciX8_2530
Enzymes [BR:gma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AciX8_2530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored HI0933_like GIDA NAD_binding_8 Pyr_redox_2 Pyr_redox_3 3HCDH_N FAD_binding_3 Lycopene_cycl Thi4
Motif
Other DBs
NCBI-ProteinID: AEU36844
UniProt: G8NZA8
LinkDB All DBs
Position
3092492..3094069
Genome map
AA seq 525 aa AA seqDB search
MKREEMIARVRERSEPWDVIVIGGGATGAGVAVDAATRGFSVLLLEREDFAKGTSSRSTK
LVHGGVRYLEQGNVSLVMEALKERGILRQNAPHLVHDVQFVVPNYSWWEAPFYGIGLKIY
DLLAGKYGFGKSELLSREETLERLPTLRQDGLRGGVIYHDGQFDDSRLLIHLIATAVDHG
AVALNYAPVIELQKDADGFVDGVIAVDSETSERFTLQARVVVNATGIFTDEIRRMADKQA
DTMVAPSQGIHLVLDRSFLRGNTAVMVPHTSDGRVLFAIPWHEHTVVGTTDTPIEHASYE
PLPFEQEIEFVLETASEYLSRPPKREDVLSIYVGIRPLVKAGGEAGKTSALSRDHTIHID
QSGLLTIVGGKWTTYRHMAEDTVNHAITLGKLADSPCVTHDLHIHGYAENIDPHEGLAVY
GSDAEHIRQLAKERPELAKQLHPDLPYIAAEVVWAARTEMARSVEDVLARRTRALFLNAH
AAIAMAPDVASLLAAEFGKDKAWAEAEVKSFNQLAKQYTLQKTEV
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcgaagagatgatcgctcgcgttcgcgaacgcagcgaaccttgggatgtaatt
gtgatcggcggcggagctaccggagctggcgtcgcggtagatgctgcgacccggggattc
tcggtcctgctgctggagcgcgaagactttgcgaagggtacctcaagccgcagcaccaag
ctagttcatggcggtgtgcgctatctggagcaaggcaatgtgtctctcgtgatggaggcc
cttaaagagcgcggcatcctccgtcagaacgcaccccatcttgttcacgatgtgcagttc
gtcgttccgaactactcctggtgggaggctcccttttacggaatcggtttgaagatctac
gacctgctcgccggcaaatatggattcggcaaatccgagcttctgtcccgtgaagagacc
ttggaacgcctgccaaccttgcggcaggacggcctacgtgggggtgtcatctatcacgat
ggtcagttcgacgactcgcgcttgttgattcacctgatcgcaaccgcagtcgaccacggc
gcagtcgcgttgaactatgctccggtcatcgagctgcaaaaagacgcagacggctttgtc
gatggtgtgatcgccgtcgacagcgagacctccgaacgcttcacgctacaggcccgcgtg
gtcgtgaatgccaccggcatctttaccgacgagatccggcggatggccgataagcaggcc
gatacgatggtcgcgcccagccagggaatccacctggtgctcgaccgctctttcctgcgc
ggtaacacagcggtgatggtgccccataccagtgatggccgcgtgctcttcgcgattccc
tggcatgaacacaccgttgttggaacgaccgacacgccgattgagcacgcttcctatgag
cctcttccctttgagcaggagatcgagtttgtgctcgagactgccagcgaatacctgagc
cggccgccaaagcgtgaggatgttctgagcatctatgtgggcattcgtcccctggtgaaa
gcaggaggcgaggccggtaagacttcggcgctctctcgcgaccacaccattcacatcgac
caatcaggattgctgacgatcgtcggcggcaagtggacgacctatcgccatatggccgaa
gatactgtgaatcatgccattacgctcggcaaactggccgacagcccctgcgtgacgcac
gacctgcatattcatggctacgcggaaaacatcgacccccatgagggcttggccgtctac
ggctctgacgcagagcatatccgtcagctcgcgaaggaacgtcccgaactagccaaacaa
cttcatcctgacttgccctacatcgcggctgaagttgtctgggcagcgaggacggagatg
gcgaggtcggtcgaagatgtacttgcgcgcagaacgcgtgccctcttcctcaatgcccat
gcggccatcgccatggcccccgatgtggcttctctgcttgcagcagagtttggcaaagac
aaggcctgggctgaagcagaggtaaagagtttcaatcaactggctaaacagtacacgcta
caaaagacagaggtatag

DBGET integrated database retrieval system