KEGG   Granulicella mallensis: AciX8_3219Help
Entry
AciX8_3219        CDS       T01664                                 

Definition
(GenBank) ribonuclease BN
  KO
K07058  membrane protein
Organism
gma  Granulicella mallensis
Brite
KEGG Orthology (KO) [BR:gma00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    AciX8_3219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB
Motif
Other DBs
NCBI-ProteinID: AEU37520
UniProt: G8NTW4
LinkDB All DBs
Position
complement(4011215..4012174)
Genome map
AA seq 319 aa AA seqDB search
MPPEISIAPRSVAPATVPEAGDEKIATNLVAAPAHPVHASGTWGQVKALGLYMTKTEVHT
YAFSVAAQVILSLFPFIVLMLTLSQKVFHSAKMFDVVGEMMTHFLPNNQDFVMRNMRVLA
YAHTKTKLVSVVMLFITATGVFLPLEVALNSVWGVRKNRSYLQNQVVSIGLAVGVAALAM
SSVALSAGQRTVMSWIFFGHTDGMVFNFIAHIFMKLCATIASIGLFFLIYWVLPNRKIPA
RAVLPTAIIVGLLWEGAKYLYVLALPHLDFRSVYGPFEVSVSLIMWAFISGLLLLAGAYV
SATRQALRETRADEIAEQR
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgccccctgagatctccatcgcgccgcgcagcgtcgctcctgcaacggttcccgaggcc
ggggacgagaagattgcgacgaacctcgtcgcggcgcctgcacatcccgtgcatgcgagc
ggaacctggggacaggtcaaggcgctcggcctctacatgaccaagaccgaggtgcatacc
tatgccttcagtgtcgcggcgcaggtgattctctccctgtttccctttatcgtgctcatg
ctcacgttgtcgcagaaggtctttcactcggcgaagatgttcgacgtcgtcggcgagatg
atgacccactttcttcccaacaaccaggacttcgtcatgcggaatatgcgcgtgctggcg
tatgcgcataccaagactaagctcgtttcggtggtgatgctcttcattacggcaaccggc
gtgttcctcccgctggaggttgcgctgaacagcgtctggggcgttcgcaagaatcgctct
tacctgcagaaccaggtggtatcgattggcctggctgtgggcgttgctgctctggcgatg
tcgtcggttgcgcttagcgcgggacagcgcaccgtgatgagttggatcttcttcgggcac
accgatgggatggtcttcaacttcatcgcgcatatcttcatgaagctatgcgcgacgatc
gccagtatcggcctgtttttcctgatctattgggtattgccgaaccgcaagattcctgca
cgggccgttctgccgacggcgatcatcgtcggtctactgtgggagggcgcgaagtatctc
tacgttctcgcgctgccgcacctcgattttcgctcggtctatgggccgtttgaggtgtcg
gtcagcctgatcatgtgggcttttatctcaggcctattgctactggcaggagcctatgtc
tcggccacacggcaggccctgcgcgagacgcgcgctgacgagatcgccgaacagcgttaa

DBGET integrated database retrieval system