KEGG   Granulicella mallensis: AciX8_3875Help
Entry
AciX8_3875        CDS       T01664                                 

Definition
(GenBank) UDP-N-acetylmuramate/alanine ligase
  KO
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
gma  Granulicella mallensis
Pathway
gma00471  D-Glutamine and D-glutamate metabolism
gma00550  Peptidoglycan biosynthesis
gma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gma00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    AciX8_3875
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AciX8_3875
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:gma01011]
    AciX8_3875
Enzymes [BR:gma01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     AciX8_3875
Peptidoglycan biosynthesis and degradation proteins [BR:gma01011]
 Precursor biosynthesis
  Amino acid ligase
   AciX8_3875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase Mur_ligase_C Mur_ligase_M F420_oxidored
Motif
Other DBs
NCBI-ProteinID: AEU38158
UniProt: G8P1E0
LinkDB All DBs
Position
complement(4896561..4897937)
Genome map
AA seq 458 aa AA seqDB search
MFAPSHRIHFIGIGGIGMSGIAEILLTMGYAVSGSDLRGSATTERLARLGATIYTGHTAA
NAAASDVVVTSSAVAKDNPEVLEARARKIPVIQRAEMLAELMRLKYGIAIAGMHGKTTTT
SMVAAVLAGGALDPTVVVGGRVDAMGSNARLGRSQYLVAEADESDRSFLKLSPILAVVTN
LDREHMDTYADLADVERVFVEFMDRVPFYGAITACVDNEMLRAILPRVTRRIYTYGESPD
ADFRLRVLRPAPDCHATFEVNTRGLVLGPFNLHVPGRHNLLNATAAVAIGVQLGIPPEKI
AAGLASFRGVDRRFQTKGVQNGVTVVDDYGHHPTEIRATLQAARECGYGRVLVLFQPHRY
TRTRDLLEDFTTAFGDADSLQVLDIYAASEQPIPGVSGESLAEKIRAASGGIVAYAGSME
EAVERLARDARPGDLVLTLGAGNVSLAGAMLLERLSVR
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcgccgtcgcaccgcatccactttattgggatcggcggcattgggatgagtggg
atcgcagagatcctgctgacgatggggtatgcggtatcgggttcggatctgcgtggctcg
gctacgaccgaacgcctggcccgtctcggggcaacgatctatacggggcacactgccgcc
aatgccgcggccagcgatgtggtggtcaccagttcggcggttgcgaaagataatcccgag
gtactggaggcgcgtgcgcgtaagattcccgtgattcagcgggcggagatgctggcggag
ctgatgcgcctgaagtacggcatcgccatcgccgggatgcatggcaagaccacgacgacc
agcatggtggcggcggtgctggcgggcggggctctggatcccacggtggtcgtagggggg
cgggtagatgcgatggggtcaaacgcccggctgggacgttcgcagtatcttgtcgccgag
gccgatgagagtgaccgctcgtttctgaagctgtcgccgatccttgccgtggtgaccaat
ctcgatcgcgagcatatggatacgtatgcggatctagccgatgtcgagcgggtgtttgtc
gagtttatggaccgcgtcccgttttatggggcgattacagcctgtgtggacaacgagatg
ctgcgcgcgattcttccccgggtgacacggcgtatctatacctatggcgagagtccggat
gcggacttcaggctgcgggtgttgcgtcctgctcccgactgccatgcgacctttgaggtg
aatacgcgcggcctggtgctggggccgttcaacctgcacgtccccgggcggcacaacctg
ctgaatgcgacggctgcggtggctatcggcgtgcagctcggcattcctccggagaagatt
gcagcgggtctggcgagctttcgcggtgttgaccgcaggtttcagaccaagggcgtacag
aacggcgtcactgttgtcgacgactacggacaccatccgacggagattcgtgcaaccctg
caggcagcgcgtgagtgcggctatggacgcgtcctggtgctctttcagccgcaccgctat
acgcgaactcgcgacctgctggaggacttcacgacggcattcggcgatgcggattcgttg
caggtgttggatatctacgccgccagtgagcagccgattccgggtgtgagcggagagtcg
ctggcggagaagatccgtgcggcttcgggcgggatcgtcgcgtatgccgggtctatggaa
gaggctgtcgagcggttggcgagagacgcgaggcctggggatctggtgctgacgctgggg
gcggggaatgtgtcgctggccggggcgatgctgctggagcggctgtcggttcgctag

DBGET integrated database retrieval system