KEGG   Granulicella mallensis: AciX8_4129Help
Entry
AciX8_4129        CDS       T01664                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase, A subunit
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
gma  Granulicella mallensis
Pathway
gma00970  Aminoacyl-tRNA biosynthesis
gma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gma00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AciX8_4129
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:gma03029]
    AciX8_4129
Enzymes [BR:gma01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     AciX8_4129
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     AciX8_4129
Mitochondrial biogenesis [BR:gma03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    AciX8_4129
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AEU38410
UniProt: G8NQU7
LinkDB All DBs
Position
complement(5276532..5277986)
Genome map
AA seq 484 aa AA seqDB search
MAEILQLETLSLSAARTAVVEGRVSAASLAAEHYERIATVDPAINSYLALSRERAMAQAE
RVDAAAKAGTALGPLAGVPIGIKDVLTMRGAPATAGSLILKGYHPPYDATCVAKLEAAGA
VLLGKLNCDEFAMGSSNENSAYGPVHNPRALDRVPGGSSGGSAAAVAAGLCVASLGTDTG
GSIRQPAAFCGVVGVLPTYGRVSRYGLIAFASSLDRVGPFTRSVADAATMLDVLAGPDPL
DATSSPQPVANYTAEAAKPVAGLRIGVPEEYFGEGLDPEIRAAIEKSLDDLRAAGCSIHK
VSLPHTRYAVPTYYVIATAEASSNLSRFDGVRYGLRAEDANTLAAMFRKSRDEGFGAEVK
RRILLGTYALSAGYYDAYYRKAQQVRTLLTRDFLSAFTQVDAIVCPVTPTPAFKLGEKTD
DPIQMYLEDIYSVAASLAGICGMSVPCGTTQAGLPIGVQILGRHFDEGTMLRVGAAVEAA
QSGR
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaatactgcaactcgaaaccctttcgctctccgcggcccgcacggctgtcgtc
gagggccgcgtctccgccgcatcgctggccgccgagcactatgagcgtatcgccaccgtc
gacccagcgatcaacagctatctcgcgctgagccgcgaacgggcgatggcccaggccgag
cgcgtagacgccgcggcgaaggccgggacggctcttggccctctggccggtgttcccatc
ggcatcaaggatgtgctgacgatgcgcggcgctccggcgacagccgggtcactcatcctg
aagggctatcatcccccctacgacgccacctgcgtcgccaagcttgaagcggcgggcgct
gtgctgcttggcaagctgaactgcgacgagttcgcgatgggctcatcgaacgagaactcg
gcctatgggccggttcacaatccgcgcgctctcgaccgcgttcccggcggatcgtcgggc
ggctctgcggcagcggttgccgcaggtctgtgtgtcgcttctctggggacggatacgggc
ggctccattcgtcagccggcggccttctgcggtgtcgttggcgtgctgccgacgtatggc
cgcgtctcgcgctacggccttattgcttttgcctcctcgctcgatcgcgtcggccccttc
acgcgctccgttgcggacgctgcgacgatgcttgatgtactggcaggccccgatccgctg
gatgctacgtcctccccccagcctgtcgcgaactataccgccgaggctgctaagccggtc
gcgggtctgcgcatcggtgtacccgaggagtactttggcgagggtctcgatccggagatt
cgtgccgccatcgagaagtctctcgacgatctgcgcgctgccggttgcagcatccacaag
gtctcgctgccgcacacgcgctatgccgtgccgacctactacgtgattgcgacggcggag
gccagctccaacctgtcgcgcttcgacggcgttcgctacggtctgcgtgcggaggatgcc
aatacgctcgccgcgatgttccgcaagtcgcgcgatgagggcttcggcgccgaggtcaaa
cggcgcattctgcttggcacctatgcactctcggcgggctactacgatgcctactatcgc
aaggcgcagcaggtacgcaccttgctgacgcgtgacttcctcagcgctttcacgcaggtc
gatgccattgtctgcccggtaacgccgacccccgcattcaagctaggtgagaagaccgac
gatccgatccagatgtacctcgaggacatctactcggtggcggcatcgctggcggggatc
tgcggtatgagtgtgccgtgtgggacgacacaggctggactgccgatcggtgtgcagatc
cttggccgtcacttcgatgagggaaccatgctgcgcgtcggcgctgccgtggaagcggcg
cagtcgggacggtag

DBGET integrated database retrieval system