KEGG   Granulicella mallensis: AciX8_4668Help
Entry
AciX8_4668        CDS       T01664                                 

Definition
(GenBank) Glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
gma  Granulicella mallensis
Pathway
gma00500  Starch and sucrose metabolism
gma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AciX8_4668
Enzymes [BR:gma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     AciX8_4668
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: AEU38938
UniProt: G8NWQ1
LinkDB All DBs
Position
complement(5926628..5929096)
Genome map
AA seq 822 aa AA seqDB search
MSVFDGTYHWLDDDGPAFGRPGLEPRWTSSQKDAVSTAYAASSRIWFTASHGTLNEIYYP
TIDRPQTRDMELLFTDEETFFHEEKRDFEYDFHYVDDDALAVRVVASDIGGRYKVTKEFI
TDPHHPVVLMNVKIEGDEAILSRLKCYALLAPHLDGGGAGNSARSVDIAGKRCILAWKNN
VSLAFGASCGFTRTSSGFVGASDGYQDLSTHMHMAWQFGQALDGNIAMMGEIEVATHREF
TIAIALGDGHHSALAGMMQTLATPYDAHLKRFIQQWQRVESPERLAKASTDGGKLLRVSH
NVILTHEDKTYSGAFIASASIPWGASKSDADLGGYHLVWTRDMVQSATAMLACGRVDTAL
RALVYLACTQHTDGGFAQNFWIDGTPYWQGIQLDEVAFPIILAWRLWKADGLGNFDIFPF
VVNASAFLVRYAPVTQQERWEENAGYSPSTLAAVISALVCAADIAIAHGSRELGTFLEDY
ADWIEAHLDEWTTTNRGMLLPDVPYHYMRIRPPAEGEPFHNPQIPPGTVHLNNREPGERF
DFEAREVIDAGFLELVRYGVRRADDPLIIDSLKVVDSVLKIDTPYGACWRRYNHDGYGQR
KDGGPYLGSGQGRAWPILTGERAHYELAAGKDVTSFVTALEKFSSIGGMLPEQVWDYADL
PSEGMYLGRSAGSAQPLVWAHAEYVKLLRSVADGKVFDRISVVEERYAVPKEKRTFQSRM
EIFQTGRPISAMCQGGTLRILDAQRFRVVYTTDNWETKNSIESRVVGRPGSFVDIQTAHD
QTGSIIFTLYWPESDHWLGRNCEVYINEELLPQGPAAMKPKS
NT seq 2469 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtcttcgacggaacgtatcactggctggatgacgatggtccagccttcggcagg
cctggacttgaaccgcgctggacttccagccagaaagacgcggtttcaacggcctatgcg
gcttccagcaggatctggtttacggcctcgcacggcacgctgaacgagatctactaccct
acgatcgaccgtccgcagacgcgcgacatggaactgctcttcaccgatgaagagaccttc
ttccatgaagagaagcgcgacttcgagtacgacttccactacgtggacgacgacgcgctg
gctgtccgcgtcgtagcgagcgatatcggcggacggtacaaggtgaccaaggagttcatt
accgacccccatcatcccgtcgtgctgatgaacgtaaagatcgagggcgacgaagcgatc
ctctcccggctcaagtgctatgcgctgctggctccgcacctggatggtggcggtgcaggg
aactcggcgcgatcggtggacatcgccggcaagcgctgcatcctggcgtggaagaacaat
gtctcgctggccttcggggccagctgcggattcacgcgcaccagttccggcttcgtgggt
gccagcgatggttatcaggatctctccacccacatgcacatggcctggcagttcggccag
gcgctcgatggcaacatcgcgatgatgggcgagatcgaggtagcaacacaccgcgagttc
acgatcgccatcgcgctcggagatggtcatcactccgcgctcgccggcatgatgcagacg
ctcgccaccccgtatgacgcgcatctcaagcgcttcattcagcagtggcagcgcgtggag
tccccggagcgtctggcgaaggcctcaaccgacggcggcaagctgctgcgcgtctcacac
aacgtcattctcacgcacgaggacaagacctactccggcgcgttcattgcgtcggcttcg
atcccgtggggagcgtccaaatccgatgccgacctgggcggttatcacctggtctggacg
cgtgacatggtgcagtcggcgacggcgatgctggcctgcggccgcgtcgataccgcgctt
cgcgcgctggtctacctcgcctgcacccagcataccgacggcggcttcgcacagaacttc
tggatcgatggaactccttactggcagggcattcagcttgacgaggtggctttcccgatc
atcctcgcgtggcggctctggaaggccgacggcctcggcaacttcgatatcttccccttc
gtggtgaacgcctcggcgttcctcgtgcgctatgcgccggtcacacagcaggagcgctgg
gaagagaatgcaggctactcgccttcgacgctggcagcggtcatctcggcgctggtttgc
gcggcggacatcgccatcgcgcacggctcgcgcgaactcggtaccttcctcgaggactat
gccgactggatcgaggcgcatctcgatgagtggacgacgacgaaccgcggcatgctgctg
cccgacgtcccgtatcactacatgcgtatccgtccgccggcagagggcgagccgttccac
aacccgcagattcctccgggcaccgtccacctcaataaccgcgagccgggcgagaggttc
gacttcgaggcgcgcgaggtgatcgacgcaggcttcctcgaactggttcgctacggagtt
cgccgggcggacgatccactcatcatcgactcgctgaaggtcgttgactcggtactgaag
atcgacaccccctacggtgcttgctggcgccgctacaaccacgacggctacggtcagcgg
aaagacggcggcccgtacctcggctcgggacagggccgtgcctggccgatcctgaccggc
gagcgcgcgcactacgagctcgcggcagggaaggatgtcacctcgttcgtgacggcgctg
gagaagttcagctccatcggcggcatgctgccggagcaggtgtgggactacgccgatctg
ccctcggagggaatgtacctgggccgctcggcgggctcggcgcagccgctggtctgggcg
catgccgagtacgtcaagctgctgcgctcggtcgccgacggcaaggtcttcgaccgcatc
tcggtcgtcgaggagcgttacgcggttcccaaggaaaagcgcacgttccagagtcgcatg
gagatcttccagaccggcaggccaatctccgcgatgtgtcagggtggcacgctgcgcatt
ctcgatgcgcaacgcttccgtgtcgtctacaccacggataactgggagacgaagaattcg
atcgagtcccgtgtggttggccgtccggggtcgttcgtcgacatccagacggcgcacgac
cagacagggagcattatcttcacgctgtactggccggagagcgatcactggctgggccgc
aactgcgaggtctatatcaacgaggagcttctgccgcagggaccagcggcgatgaagccg
aagtcgtaa

DBGET integrated database retrieval system