KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_0068Help
Entry
GY4MC1_0068       CDS       T01348                                 

Definition
(GenBank) Hsp33 protein
  KO
K04083  molecular chaperone Hsp33
Organism
gmc  Geobacillus sp. Y4.1MC1
Brite
KEGG Orthology (KO) [BR:gmc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:gmc03110]
    GY4MC1_0068
Chaperones and folding catalysts [BR:gmc03110]
 Heat shock proteins
  HSP33
   GY4MC1_0068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33
Motif
Other DBs
NCBI-ProteinID: ADP72924
UniProt: A0A0F6BHM3
LinkDB All DBs
Position
81512..82402
Genome map
AA seq 296 aa AA seqDB search
MSDYLVKALAYDGQVRAYAARTTDTVSEAQRRHQTWPTASAALGRAITAGVMMGAMLKGD
DKLTIKIDGGGPIGTILVDSNAKGEVRGYVTNPHVHFDLNEHGKLDVAKAVGTNGMLTVV
KDLGLRDFFTGQVPIVSGELGEDFTYYFASSEQVPSSVGVGVLVNPDNTILAAGGFIIQL
MPGTEEKTIDEIEKRLRTIPPVSKMVESGLTPEEILEELLGKGNVKVLETIPVAFVCRCS
RERIADALISLGAQEIQDIIDKEGYAEASCHFCNETYHFSKEELQQLKQLADAKEE
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgtcagactacttagtaaaggctttagcttatgatggacaagtaagagcgtatgctgct
cgaacaacagatacagtaagcgaggcgcagcgccgccatcaaacatggccgactgcttct
gcggcgcttggccgggctattacggcgggagtcatgatgggagccatgttaaagggtgat
gataaattaacgattaaaattgatggcggcggtccgattggcaccatcctcgtcgacagc
aatgcgaagggagaggtgcgtgggtacgtaacaaatccacacgtccactttgatttaaac
gaacatgggaaattggacgtcgccaaagcggtaggcacaaacggcatgttaacggtcgta
aaagatttagggctgcgcgattttttcacagggcaagtgccgattgtctcaggagaactt
ggtgaagattttacgtattattttgcttcttctgagcaagttccatcttctgtcggcgtc
ggtgtgcttgtcaatcccgataacacgatcttggcggcgggaggctttatcatccagctg
atgccgggaacggaagagaagacaattgatgagattgaaaaacgcttgcggactattcca
cctgtctcgaaaatggtagagagtggattgacgccagaagagattttggaagagttgctt
ggaaaaggaaatgtcaaagtgctagaaacaattccagtcgcgtttgtttgccgctgttcg
cgggagcgaattgcggatgcgttgatcagtttaggcgcgcaggaaattcaagacattatc
gacaaagaagggtatgctgaagcgtcatgccatttctgcaatgaaacgtaccatttcagc
aaagaggaactccagcagctgaaacagcttgctgatgcgaaagaagaataa

DBGET integrated database retrieval system