KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_0108Help
Entry
GY4MC1_0108       CDS       T01348                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
gmc  Geobacillus sp. Y4.1MC1
Brite
KEGG Orthology (KO) [BR:gmc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:gmc03012]
    GY4MC1_0108
   03029 Mitochondrial biogenesis [BR:gmc03029]
    GY4MC1_0108
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gmc04147]
    GY4MC1_0108
Translation factors [BR:gmc03012]
 Eukaryotic Type
  Elongation factors
   GY4MC1_0108
 Prokaryotic Type
   GY4MC1_0108
Mitochondrial biogenesis [BR:gmc03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    GY4MC1_0108
Exosome [BR:gmc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   GY4MC1_0108
  Exosomal proteins of breast cancer cells
   GY4MC1_0108
  Exosomal proteins of colorectal cancer cells
   GY4MC1_0108
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ADP72964
UniProt: A0A0F6BHR3
LinkDB All DBs
Position
133163..134350
Genome map
AA seq 395 aa AA seqDB search
MAKAKFERTKPHVNIGTIGHVDHGKTTLTAAITTVLAKQGKAEAKAYDQIDAAPEERERG
ITISTAHVEYETDKRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLSRQVGVPYIVVFLNKCDMVDDEELLELVEMEVRDLLSEYDFPGDEVPVIKGSALKALE
GDPQWEEKIVELMNAVDEYIPTPQREIDKPFMMPIEDVFSITGRGTVATGRVERGTLKVG
DAVEIVGLSDEPKSTTVTGVEMFRKLLDQAEAGDNIGALLRGVSRDEVERGQVLAKPGTI
TPHTKFKAQVYVLTKEEGGRHTPFFSNYRPQFYFRTTDVTGIITLPEGVEMVMPGDNVEM
TVELIAPIAIEEGTKFSIREGGRTVGAGSVSEIIE
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagcgaaattcgaacgtacgaaaccacacgtcaacattggtactatcggccac
gttgaccatggtaaaacgacgttaactgctgcgattacaacagttctcgctaaacaaggt
aaagcagaagcaaaagcgtacgatcaaatcgacgcagctccagaagaacgtgaacgtggt
atcactatctctactgcgcacgttgagtatgaaacagacaaacgccactatgctcacgtt
gactgccctggccacgcagactacgtgaaaaacatgatcacaggtgcagcgcaaatggac
ggtgcaatccttgttgtgtctgcggctgacggtccaatgccacaaactcgtgagcacatt
cttctttctcgccaagtaggtgtgccatacatcgttgtattcttgaacaaatgcgacatg
gttgacgacgaagaattgctagaacttgttgaaatggaagttcgtgatctattatctgaa
tatgatttccctggcgacgaagtgcctgttatcaaaggttctgcgttaaaagcgcttgaa
ggcgatccgcaatgggaagaaaaaattgttgaattgatgaatgcggttgacgaatatatc
ccaactccgcaacgcgaaattgacaaaccattcatgatgccaatcgaagacgtattctcg
atcactggtcgcggtacagtagcaactggccgtgttgaacgcggtacgttaaaagttggc
gatgctgttgaaatcgttggtctttctgatgaaccaaaatctacaacggttactggcgtt
gaaatgttccgcaaacttcttgaccaagcagaagctggtgacaacatcggtgcgcttctt
cgcggtgtgtcccgtgatgaagttgagcgcggtcaagttcttgcaaaaccaggaacaatt
acaccacatacaaaatttaaagctcaagtttacgtcctaacaaaagaagaaggtggacgc
catactccattcttctctaactatcgtccacaattctacttccgtacaacggacgtaaca
ggcatcatcacgcttcctgaaggcgttgaaatggttatgcctggcgacaacgttgaaatg
acagttgaattaatcgcgccaatcgcgatcgaagaaggtacaaaattctcgatccgtgaa
ggcggacgtactgtaggtgctggctctgtatctgaaatcattgaataa

DBGET integrated database retrieval system