KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_0498Help
Entry
GY4MC1_0498       CDS       T01348                                 

Definition
(GenBank) glycine cleavage system H protein
  KO
K02437  glycine cleavage system H protein
Organism
gmc  Geobacillus sp. Y4.1MC1
Pathway
gmc00260  Glycine, serine and threonine metabolism
gmc00630  Glyoxylate and dicarboxylate metabolism
gmc01100  Metabolic pathways
gmc01110  Biosynthesis of secondary metabolites
gmc01130  Biosynthesis of antibiotics
gmc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gmc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    GY4MC1_0498
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GY4MC1_0498
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_H Biotin_lipoyl RnfC_N
Motif
Other DBs
NCBI-ProteinID: ADP73330
UniProt: A0A0F6BIS9
LinkDB All DBs
Position
535247..535630
Genome map
AA seq 127 aa AA seqDB search
MNTPKELRYSEEHEWVRVEGDKVRIGITDFAQSELGDIVFVELPEVGTEITANEPFGSVE
SVKTVSELYAPISGKVVEVNEALNDNPEYVNESPYEKAWMIVVEPSDISEIDNLLTAEQY
EAMVKEG
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgaatacgccaaaggaattacgttattcggaagaacatgagtgggtgcgcgtcgaaggg
gataaagtgcgcatcggcattactgattttgcgcaatctgaattaggcgacatcgttttt
gttgagctgccggaagtaggtacagaaattacggcaaatgaaccgttcggcagcgtggag
tctgtaaaaacggtttccgaactttatgcgccgattagcggcaaagtagtagaagtgaat
gaagcattaaatgataatccagaatatgtaaatgaatctccatatgaaaaagcgtggatg
attgttgttgagccttccgatatcagcgagatcgataatttattaacagcagagcaatat
gaagcaatggtaaaagaaggatga

DBGET integrated database retrieval system