KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_0828Help
Entry
GY4MC1_0828       CDS       T01348                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
gmc  Geobacillus sp. Y4.1MC1
Pathway
gmc00010  Glycolysis / Gluconeogenesis
gmc00030  Pentose phosphate pathway
gmc00051  Fructose and mannose metabolism
gmc00052  Galactose metabolism
gmc00680  Methane metabolism
gmc01100  Metabolic pathways
gmc01110  Biosynthesis of secondary metabolites
gmc01120  Microbial metabolism in diverse environments
gmc01130  Biosynthesis of antibiotics
gmc01200  Carbon metabolism
gmc01230  Biosynthesis of amino acids
gmc03018  RNA degradation
Module
gmc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
gmc_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:gmc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GY4MC1_0828
   00030 Pentose phosphate pathway
    GY4MC1_0828
   00051 Fructose and mannose metabolism
    GY4MC1_0828
   00052 Galactose metabolism
    GY4MC1_0828
  09102 Energy metabolism
   00680 Methane metabolism
    GY4MC1_0828
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    GY4MC1_0828
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:gmc01009]
    GY4MC1_0828
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:gmc03019]
    GY4MC1_0828
Enzymes [BR:gmc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     GY4MC1_0828
Protein phosphatases and associated proteins [BR:gmc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     GY4MC1_0828
Messenger RNA biogenesis [BR:gmc03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     GY4MC1_0828
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: ADP73643
UniProt: A0A0F6BJP2
LinkDB All DBs
Position
830189..831148
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAIRAVVRKAIYHGVEVYGVYHGYAGLIAGKIKKLEVGDVGDI
IHRGGTILYTARCPEFKTEEGQLKGIEQLKKYGIEGLVVIGGDGSYQGAKKLTEHGFPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWS
GLAGGAETILIPEADYDMDDVIARLKRGHERGKKHSIIIVAEGVGSGVEFGKKIQEATGF
ETRVTVLGHVQRGGSPTAFDRVLASRLGARAVELLLEGKGGRCVGIQNNQLVDHDIAEAL
ANKHTIDQKMYLLSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtataggtgtattaacaagtggcggagattcaccaggtatgaatgcggcgatc
cgcgccgtcgtccgcaaggcgatttaccatggagtagaagtatatggagtgtaccatggg
tatgctggtttaatcgctggaaaaataaaaaagttggaagtgggagatgtcggcgacatc
atccaccgcgggggaacgatactgtatacggcgcgctgtccggaatttaagacagaagag
gggcagttaaaagggattgaacaattgaaaaaatacggcatcgaaggattagtcgtgatt
ggtggggacggttcctaccaaggagcgaaaaagctaacagagcacggttttccttgtgtc
ggagtgccgggaacgattgacaatgacattcctggaacggattttacgattggatttgac
acggcgttaaatactgtaattgacgcgatcgacaaaattcgcgataccgctacatcacat
gaacggacatatgtgattgaagtaatgggacgccacgccggggatattgcgttatggtca
gggcttgccggaggggcggaaacgattttgattccagaagctgattacgatatggatgat
gttattgctcggttaaaacgcggacatgaacgcggcaaaaagcatagcattattatcgtt
gccgaaggtgtcggaagcggggtcgaatttggcaagaaaattcaagaagcgacagggttt
gaaacgcgcgttaccgtactggggcatgtgcagcgcggtggttctccaaccgcatttgac
cgcgtgttggccagccgtttaggtgctcgggcagtagaactattattagaaggcaaaggc
ggccgctgcgttggcatccaaaataatcagcttgtcgaccatgatattgcggaagcgttg
gccaacaaacatactattgatcaaaaaatgtatttgttgtcaaaagagctatccatttag

DBGET integrated database retrieval system