KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_0834Help
Entry
GY4MC1_0834       CDS       T01348                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
gmc  Geobacillus sp. Y4.1MC1
Pathway
gmc00020  Citrate cycle (TCA cycle)
gmc00480  Glutathione metabolism
gmc01100  Metabolic pathways
gmc01110  Biosynthesis of secondary metabolites
gmc01120  Microbial metabolism in diverse environments
gmc01130  Biosynthesis of antibiotics
gmc01200  Carbon metabolism
gmc01210  2-Oxocarboxylic acid metabolism
gmc01230  Biosynthesis of amino acids
Module
gmc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gmc_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:gmc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GY4MC1_0834
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    GY4MC1_0834
Enzymes [BR:gmc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     GY4MC1_0834
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ADP73649
UniProt: A0A0F6BJP8
LinkDB All DBs
Position
836637..837911
Genome map
AA seq 424 aa AA seqDB search
MVTQGEKITVTNGVLNVPNNPIIPFIEGDGTGPDIWAAASRVLEAAVEKAYKGEKKIVWK
EVLAGEKAYKQTGEWLPQETLDVIREYIIAIKGPLTTPVGGGIRSLNVALRQELDLFVCL
RPVRYFKGVPSPVKRPEDTDMVIFRENTEDIYAGIEYAKGTPEVKKVIDFLQNEMGVRKI
RFPETSGIGIKPISEQGTKRLVRAAIKYAIDHGRKSVTLVHKGNIMKFTEGAFKNWGYEL
AEEEFSDKVFTWAQYDRIVETEGKEAANKALAEAEEAGKIIIKDVIADIFLQQILTRPRE
FDVVATMNLNGDYISDALAAQVGGIGIAPGANINYETGHAIFEATHGTAPKYAGLDKVNP
SSVILSGVMMFEHLGWNEAAKLIVDALEKTIASKIVTYDFARLMEGATEVKCSEFADAII
RNME
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggtgacgcaaggggaaaaaattacagtaacgaatggtgtgttaaacgtaccaaacaat
ccgattattccatttattgaaggagacgggacaggaccggacatttgggcggcggcatcc
cgcgtgttagaagctgcggtcgaaaaggcgtataaaggcgaaaagaaaatcgtttggaaa
gaagtgcttgcgggtgaaaaagcgtacaagcaaaccggcgagtggcttccacaagaaacg
cttgatgtgattcgtgaatacataattgctattaaaggtccattaacgactccggtcggc
ggcggcatccgttcattgaacgtagcgctgcgccaagaattggacttattcgtttgcttg
cgccctgtccgctattttaaaggtgttccttctccggtgaaacgccctgaagatacggac
atggtcattttccgtgaaaacacggaagacatttacgcaggaattgagtatgcaaaagga
acgccagaagtgaaaaaagtgattgatttcttgcaaaatgaaatgggcgttcgcaaaatc
cgcttcccagaaacgtctggtatcggcattaagccaatttctgagcaaggaacgaagcgg
ttagtgcgcgccgctatcaagtatgcgattgatcatggacgaaaatcggtgacgcttgtt
cataaaggaaatattatgaaattcacagaaggcgcatttaaaaattggggctatgaatta
gcggaagaagaatttagcgataaagtatttacatgggcacaatatgaccgcattgtcgaa
acagaaggaaaagaagcggcgaataaagcgctggcggaagcagaagaagctggaaaaatt
attatcaaagacgtcattgccgatattttcttgcaacaaattttgacgcgcccgcgtgag
ttcgatgttgtggcgacaatgaacttaaacggcgactacatttctgacgcgctggcagcg
caagtcggcggcattggtatcgctccgggagcgaacattaactacgaaacaggacatgcg
atttttgaggctactcatggaacggctccgaaatatgctggcttggacaaagtgaatccg
tcatctgtcattttgtccggtgtaatgatgtttgaacatctcggctggaacgaagcggca
aagcttatcgtcgatgcgctggaaaaaacgattgcttccaaaatcgtcacatacgatttt
gcccgtctgatggaaggcgctactgaagtgaaatgctccgaattcgctgacgcaatcatc
cgcaatatggaataa

DBGET integrated database retrieval system