KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_0966Help
Entry
GY4MC1_0966       CDS       T01348                                 

Definition
(GenBank) Prephenate dehydratase
  KO
K04518  prephenate dehydratase [EC:4.2.1.51]
Organism
gmc  Geobacillus sp. Y4.1MC1
Pathway
gmc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
gmc01100  Metabolic pathways
gmc01110  Biosynthesis of secondary metabolites
gmc01130  Biosynthesis of antibiotics
gmc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gmc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GY4MC1_0966
Enzymes [BR:gmc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     GY4MC1_0966
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDT ACT Ehbp SBP_bac_3
Motif
Other DBs
NCBI-ProteinID: ADP73780
UniProt: A0A0F6BK29
LinkDB All DBs
Position
973636..974484
Genome map
AA seq 282 aa AA seqDB search
MKIGYLGPKATFTDLAVTTMFPHAEKIPYSTIPECIDAVSNGEIDAGVVPLENALEGSVN
LTLDYLIHEQSLPIVGEIIAPIQQHLMVHPYHAHHWTEVKEIYSHSHAIAQCHKFLHANL
KKAKHVYMTSTSAAAKFVSEHPHLPIAAIANRLAAKEYGLMIVQENIHDHDYNHTRFIIV
RKQNEPLKMDSPLYAGDKTTLMVALPKDQPGALHQVLSAFAWRKLNLTKIESRPAKTGLG
NYFFIIDIDQKMDDVLIPGAIAELEALDCTVQVLGSYPYYII
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattggctatttaggaccgaaagcgacatttactgatttagcggtaaccaccatg
tttcctcacgcagaaaaaatcccgtattctaccattccggagtgcatcgatgcggtaagc
aacggagagattgacgccggggtggtgccgctcgagaacgcgctggaaggatcggtgaat
ttaacgcttgattatttaatccatgaacaatcgcttccgattgtcggggaaattatcgct
ccgattcaacaacatttaatggtgcatccgtaccacgcgcatcattggacggaagtgaaa
gaaatttattcccactcgcatgcgattgcgcaatgccataaatttttgcatgcgaattta
aaaaaagcgaagcatgtatatatgacatcgacaagcgcggcggcgaaattcgtcagcgaa
catccgcaccttccgatcgcggcgattgccaaccggctggcggctaaagaatacgggctt
atgatcgtgcaagaaaacattcatgaccatgattacaaccatacgcgttttattatcgtc
cgcaagcaaaacgaaccgctgaaaatggactcaccgctttatgccggcgataaaacgacg
ctgatggtggcgcttccaaaagaccagcctggcgctcttcaccaagtgctttccgcgttt
gcctggcgcaaattaaatttgacaaaaatcgaatcccgccctgcgaaaacagggcttggc
aactattttttcattattgacatcgatcaaaaaatggacgatgtgctaattccgggcgcc
attgcggagcttgaggcgcttgattgcaccgtccaagtattaggaagttacccgtattat
attatttga

DBGET integrated database retrieval system