KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_1597
Entry
GY4MC1_1597       CDS       T01348                                 

Definition
(GenBank) 2-oxopent-4-enoate hydratase
  KO
K01617  2-oxo-3-hexenedioate decarboxylase [EC:4.1.1.77]
Organism
gmc  Geobacillus sp. Y4.1MC1
Pathway
gmc00362  Benzoate degradation
gmc00621  Dioxin degradation
gmc00622  Xylene degradation
gmc01100  Metabolic pathways
gmc01120  Microbial metabolism in diverse environments
gmc01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:gmc00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GY4MC1_1597
   00622 Xylene degradation
    GY4MC1_1597
   00621 Dioxin degradation
    GY4MC1_1597
Enzymes [BR:gmc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.77  2-oxo-3-hexenedioate decarboxylase
     GY4MC1_1597
SSDB
Motif
Pfam: FAA_hydrolase
Other DBs
NCBI-ProteinID: ADP74374
LinkDB
Position
1564624..1565427
AA seq 267 aa
MLKTEVIDSIVDELFLAEKHGKAIPKLVDRYPGLNVDLAYEVQNRLIERKCRDEGTKVAG
WKLGLTSKAKQEMMGVHEPTYGVLLENMQLQSDGSISLRTLIHPKIEPEIAFIFKEELKG
PGVTVAEVLQKTDYIAPALEIIDSRYQHFSFTLADVIADNSSSSRFILGERFAKYNGEDL
SLVGMVFKKNGAIVSTSAGASVMGHPARAVAWMVNKLSRYGQSVKPGEVVLSGALTGAIE
IKEGDVFSVSLDRFGSVEASFTFGKGE
NT seq 804 nt   +upstreamnt  +downstreamnt
atgctaaaaacagaagttatcgattccatcgtcgatgaattgttccttgccgaaaagcat
gggaaggcgattccgaaactggtcgatcgttatcccggattgaatgttgatcttgcttac
gaagtacaaaaccggttgattgaacgcaaatgccgggacgaagggacgaaagtggccggc
tggaaattggggttgacaagcaaagccaagcaggaaatgatgggggtccatgagccgact
tacggagttttgctggagaatatgcagttgcaaagcgatggctccatttctttaagaaca
ttaatacacccaaaaattgaaccggagattgcctttatttttaaagaggaactaaaagga
ccgggcgttaccgtggcagaagttttgcaaaagacggactacatcgcgccggcgcttgaa
atcattgacagccgctatcaacatttttctttcacgttagcggatgtcattgctgataat
tcttcttcttcccgcttcattttaggagaacgttttgcgaaatataatggggaagattta
agcttagtcggcatggtttttaaaaagaacggcgccattgtttcaacgagcgctggcgca
agcgtgatggggcatccggcaagggctgtcgcctggatggtgaacaaactttcccgttac
ggccaatcagtaaagccgggagaagtcgttctcagcggggcgttaaccggtgcgatagaa
atcaaagaaggagacgtattctccgtgagcttggatcgctttggctcggttgaagcctct
tttaccttcggaaagggggagtaa

DBGET integrated database retrieval system